SecReT6
Protein ID: 322420531
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3035
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3601163..3602560 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDE8WHS8
KEGG IDgeb:GM18_3035
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-90, Aligned region: 20..462
Protein Sequence: 465 a.a.     [Download]
>gi|322420531|ref|YP_004199754.1| type VI secretion protein [Geobacter sp. M18]
MDAPQGPILWHQGMFLQPQHFQLAQRCTYSLFIPYQRYLVPHLWGVCRGAVRTSSVGLCALELTSGTFLF
PDGTYVQLPGNAVVEPRMLPEGAVVKGAPVTAYVGLKKWQEQAENVSTARKGDVVGTITTRYVAAADGIS
CPDLHAGGPAAEVRQLNHVLKIFWQSELDLLGDYLLIPLARLEIRSEEIEISRDFIPPCLSIAASSLLFD
LVREIRDQLALRCRRLESGKKQRGIQSAEFGSKDLVYLFALRTLNRYLAQLDHFIQAGDIHPWHVYGVLA
QLVAELSCFSETVSFSGDSMADGTVLLPEYCHLDLGGCFSQAHDLILKLLDQVTAGPEYALKLSYDGTYF
CSDLKPAHFQGRNRFYLVVRTDAEPAAVLGSLTGLAKLSPRERLPLLIAQALPGIPLEHLPTPPRELPRR
ASSLYFGIDTRCDQWELVQKWNNIALFWDQAPDDLEAELMIVTRG
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3602560-3601163 Geobacter sp. M18 chromosome, complete genome
ATGGACGCGCCACAAGGTCCCATCCTCTGGCACCAGGGCATGTTCCTGCAGCCGCAGCACTTCCAGCTGG
CGCAGCGCTGCACGTATTCCCTGTTCATCCCGTACCAGAGGTATCTGGTGCCGCACCTTTGGGGAGTGTG
CCGCGGGGCGGTCAGGACCTCCTCCGTCGGCCTTTGCGCCCTGGAACTCACCAGCGGCACCTTTTTGTTC
CCCGACGGAACCTATGTGCAACTGCCGGGCAACGCCGTCGTGGAGCCGCGCATGTTGCCCGAGGGGGCGG
TGGTAAAGGGAGCCCCGGTGACCGCATATGTAGGGCTGAAGAAATGGCAGGAGCAGGCGGAAAACGTATC
GACCGCCCGAAAGGGCGATGTCGTCGGCACGATAACCACGCGCTACGTCGCTGCTGCGGACGGAATCTCC
TGCCCGGATCTTCACGCAGGCGGCCCGGCTGCAGAAGTGCGGCAACTGAACCACGTGCTGAAGATATTCT
GGCAGAGCGAGCTGGACCTTCTGGGGGACTACCTGCTCATCCCGCTGGCCCGGCTGGAAATCCGCAGCGA
GGAGATCGAGATATCCCGCGACTTCATCCCCCCTTGTCTCAGTATCGCTGCTTCTTCGCTGCTGTTTGAC
CTGGTGCGGGAAATACGGGACCAACTCGCACTCCGTTGCCGGCGGTTGGAGAGCGGCAAGAAGCAGCGCG
GCATCCAAAGCGCCGAATTCGGCTCGAAGGATCTGGTCTACCTCTTCGCCCTCAGGACGCTGAACCGGTA
CCTGGCGCAGCTCGACCATTTCATTCAAGCCGGCGACATTCATCCCTGGCACGTGTATGGGGTCCTCGCG
CAACTGGTCGCGGAACTCTCCTGCTTTTCCGAAACCGTCTCCTTTTCCGGTGATTCCATGGCCGACGGCA
CGGTGCTACTGCCGGAGTACTGCCACCTCGACCTGGGCGGCTGCTTCTCGCAAGCCCATGATCTGATCCT
GAAGCTCCTGGATCAGGTCACAGCGGGGCCGGAGTATGCGCTCAAGCTCTCCTACGATGGCACCTATTTC
TGTTCGGATCTCAAACCCGCCCATTTCCAGGGACGTAACCGGTTCTATCTGGTGGTGAGGACGGACGCGG
AACCAGCCGCGGTCTTAGGATCTCTGACCGGCCTGGCAAAGCTGAGCCCCCGCGAGAGGCTCCCTCTTCT
GATCGCCCAGGCCCTGCCGGGGATTCCCCTGGAACACCTCCCCACCCCGCCCCGGGAACTCCCGCGCCGG
GCCTCATCCCTCTACTTCGGCATCGACACCCGCTGCGACCAATGGGAGCTCGTGCAGAAGTGGAACAACA
TCGCCCTGTTTTGGGATCAGGCGCCGGACGACCTTGAAGCCGAACTGATGATAGTGACCAGGGGGTGA