SecReT6
Protein ID: 322420532
SecReT6 ID505
T6SS typei4a
Gene symbol-
Locus tagGM18_3036
StrainGeobacter sp. M18
Repliconchromosome [GenBank: NC_014973] [Browse all T6SS(s) in this replicon]
Location [Strand]3602560..3603063 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE8WHS9
KEGG IDgeb:GM18_3036
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.10E-23, Aligned region: 12..146
Protein Sequence: 167 a.a.     [Download]
>gi|322420532|ref|YP_004199755.1| type VI secretion lipoprotein [Geobacter sp. M18]
MNRIVLVIFAVAFLSGCSPKMRSAQSGARPSPSEVIHLKVQADPQLNRYDKASHALLLCLYQLKDPDGFR
QLAQDKDGVPKLLECGRFDASVVNARLIVVQPGQNLSQTCDKGEDARYVGLATGYYGLGKMKVTELFALP
TRVADEALPGLLHVDLGAQEIRNARVE
 
Nucleotide Sequence: 504 bp     [Download]
>gi|322417545|ref|NC_014973.1|:c3603063-3602560 Geobacter sp. M18 chromosome, complete genome
ATGAACAGGATAGTTCTTGTTATTTTCGCTGTTGCTTTCCTCTCGGGTTGCTCGCCGAAAATGCGGTCGG
CCCAGAGCGGTGCGCGCCCATCGCCAAGTGAGGTGATCCACCTCAAGGTGCAGGCGGATCCTCAACTAAA
CCGCTACGACAAGGCGTCCCACGCCCTGCTGCTCTGCCTGTACCAACTGAAGGATCCCGACGGTTTCAGG
CAGTTGGCGCAGGACAAGGACGGCGTTCCCAAACTCCTGGAGTGCGGCCGCTTCGATGCCTCGGTGGTGA
ACGCCAGGCTCATAGTCGTCCAGCCCGGACAGAACCTGAGCCAGACCTGCGACAAGGGGGAAGACGCCCG
CTATGTCGGCCTGGCAACCGGCTACTACGGCCTGGGCAAAATGAAGGTAACCGAGCTCTTTGCGCTACCG
ACCCGTGTTGCCGATGAAGCCTTGCCAGGTTTGCTTCACGTGGATCTGGGGGCGCAGGAAATAAGAAATG
CGAGGGTGGAGTGA