SecReT6
Protein ID: 322432861
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_3996
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]8653..10689 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDE8X5Q8
KEGG IDacm:AciX9_3996
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.80E-64, Aligned region: 20..334
Phage_base_V [PF04717], Evalue: 3.00E-20, Aligned region: 375..468
Phage_base_V [PF04717], Evalue: 3.00E-20, Aligned region: 580..604
Gp5_C [PF06715], Evalue: 0.003, Aligned region: 521..538
Gp5_C [PF06715], Evalue: 0.003, Aligned region: 569..591
Protein Sequence: 678 a.a.     [Download]
>gi|322432861|ref|YP_004210110.1| ImpA family type VI secretion-associated protein [Granulicella tundricola MP5ACTX9]
MKFTSPLGPDELVIETLEGTEGISRLFEFQGELLADAGTEIELSAIMGQKVTVEISLVETQGSRYINGMV
NGFVQMGGDTDFDVYHVHIVPSLWQLTLATNCRVFQGKTVMDIIKAVITPYGLSVGDKTEGTLQALDYCT
QYNETDFNFISRLAEQHGIFYWFEHSDSDNKVNFGNSRTAYADCPLVNTVTYSPNSDVSQDRYVSSIQNF
SSTATMVTGRHITGDYDYRTFDPNKVDGVPTTSTFANNTFSNYYWPGGEEGYVKLETKQLSTPQHAKGFL
ANRAGASDLEAEVLHGVSSARTMTSGYTFTMTDHTNDAWNRKYLLTEISHQVDQIPSYRSTTGGDDGEYR
NRFTAVSSDLVFRPRLVTPKPLIHGPQTAFVVTAKGEDIHIDKLGRVCVQFWWDYQRPDGNTIDNTWVRV
AQSWAGNGWGTYFWPRTEDEVIVQFLNGDPDNPIIVGSVYNGTNVPKYALPDMSTRSGILTRSSQGGGAA
NANELRFEDKMGSEQIFINAEHDMDHRIENDHREYVKNLKSVMVDGSHYDQTGGDRHSTLNANKVEKIKE
KMSLDVGTDRNEKVGGNVSLQVGTNMAEKVGMNYSMDAGMEVYIKAGMTLVIESGMELCLKGAGGFITIG
PAGIAISGTMVMINSGGAAVSGTAGTIVDPDPPTAPDQADDGTKGGKM
 
Nucleotide Sequence: 2037 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c10689-8653 Granulicella tundricola plasmid pACIX901, complete sequence
ATGAAATTCACCAGCCCTCTGGGGCCGGATGAGCTTGTGATCGAGACGCTGGAAGGTACGGAAGGAATCT
CGCGCCTATTCGAGTTTCAAGGCGAGTTGCTGGCGGACGCCGGCACCGAGATCGAGCTGTCGGCGATCAT
GGGGCAAAAGGTTACGGTGGAGATCTCGCTGGTCGAGACGCAGGGCAGCCGGTATATCAACGGCATGGTC
AATGGGTTTGTGCAGATGGGTGGGGATACCGATTTCGATGTGTATCACGTCCACATCGTTCCCTCTCTCT
GGCAGTTGACACTGGCGACCAACTGCCGTGTCTTCCAAGGCAAGACCGTGATGGACATTATCAAGGCTGT
GATTACGCCCTACGGCTTGAGCGTTGGCGATAAGACGGAAGGGACGCTGCAGGCGCTCGACTACTGCACG
CAGTACAACGAGACGGACTTCAACTTCATCTCGCGCCTGGCGGAGCAGCACGGCATCTTTTACTGGTTTG
AACACTCGGACAGCGACAACAAGGTGAACTTCGGCAACTCGCGGACTGCCTATGCGGATTGCCCGCTTGT
GAACACCGTTACGTATTCGCCGAACTCCGATGTTTCGCAGGACCGGTATGTGTCTTCCATCCAGAACTTC
AGTTCAACGGCGACGATGGTGACGGGGCGCCATATCACCGGCGACTACGACTATCGCACCTTCGACCCGA
ATAAGGTGGATGGCGTGCCGACCACAAGCACGTTCGCGAATAACACGTTCAGCAACTACTACTGGCCCGG
CGGCGAAGAAGGATACGTCAAGCTGGAGACAAAGCAGCTTTCGACCCCGCAGCACGCGAAGGGATTTCTG
GCGAACCGTGCGGGAGCGAGCGACCTGGAGGCAGAGGTCCTTCATGGGGTATCCAGCGCACGCACGATGA
CAAGCGGCTATACGTTCACGATGACGGACCATACGAACGACGCCTGGAATCGCAAGTACCTGTTGACGGA
GATATCTCACCAGGTGGACCAGATTCCCTCCTACCGAAGCACGACGGGGGGAGACGACGGGGAGTATCGC
AATCGATTTACAGCTGTTTCAAGCGACCTTGTATTTCGTCCCCGGCTGGTTACCCCAAAGCCGCTGATTC
ATGGACCGCAGACGGCATTCGTGGTTACGGCCAAGGGCGAGGATATTCACATCGACAAGCTGGGGCGTGT
CTGCGTGCAGTTCTGGTGGGACTACCAGCGGCCGGACGGCAATACGATCGACAACACCTGGGTTCGGGTG
GCGCAGTCCTGGGCTGGGAATGGGTGGGGCACTTACTTCTGGCCTCGAACGGAGGATGAGGTCATTGTTC
AGTTTTTGAATGGCGATCCGGATAATCCGATCATCGTGGGCTCGGTCTATAACGGGACCAATGTTCCAAA
GTACGCACTGCCTGACATGAGCACGCGCAGCGGAATCCTGACGCGAAGCAGTCAGGGTGGTGGCGCTGCG
AATGCGAATGAACTGCGGTTCGAGGACAAGATGGGGAGCGAGCAGATCTTCATCAACGCCGAGCACGACA
TGGATCATCGGATTGAGAACGATCACCGCGAGTACGTCAAGAACCTGAAGTCGGTGATGGTTGACGGATC
TCACTACGATCAAACGGGGGGAGATCGTCATTCAACGCTGAACGCGAACAAGGTTGAAAAGATCAAAGAG
AAGATGAGTCTCGATGTGGGTACGGACCGCAATGAGAAGGTGGGTGGGAACGTATCGCTTCAGGTCGGAA
CGAATATGGCTGAGAAGGTCGGGATGAACTACTCCATGGATGCGGGGATGGAGGTGTACATCAAAGCCGG
GATGACGCTGGTGATCGAAAGCGGGATGGAGCTTTGTCTGAAGGGGGCAGGCGGGTTTATCACGATTGGG
CCGGCCGGGATTGCGATCTCGGGCACGATGGTGATGATCAATAGCGGTGGCGCCGCTGTCTCTGGGACTG
CGGGCACGATCGTGGATCCCGATCCTCCGACTGCTCCCGACCAGGCCGACGACGGCACCAAGGGCGGCAA
GATGTAG