SecReT6
Protein ID: 322432862
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_3997
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]10797..13457 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE8X5Q9
KEGG IDacm:AciX9_3997
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.00E-40, Aligned region: 230..259
AAA_2 [PF07724], Evalue: 3.00E-40, Aligned region: 612..777
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 230..362
AAA [PF00004], Evalue: 2.70E-19, Aligned region: 618..711
ClpB_D2-small [PF10431], Evalue: 4.50E-17, Aligned region: 729..750
ClpB_D2-small [PF10431], Evalue: 4.50E-17, Aligned region: 787..863
AAA_5 [PF07728], Evalue: 2.00E-13, Aligned region: 230..253
AAA_5 [PF07728], Evalue: 2.00E-13, Aligned region: 617..735
AAA_16 [PF13191], Evalue: 6.70E-12, Aligned region: 207..252
AAA_16 [PF13191], Evalue: 6.70E-12, Aligned region: 274..308
AAA_16 [PF13191], Evalue: 6.70E-12, Aligned region: 482..482
AAA_16 [PF13191], Evalue: 6.70E-12, Aligned region: 615..661
AAA_16 [PF13191], Evalue: 6.70E-12, Aligned region: 682..706
AAA_16 [PF13191], Evalue: 6.70E-12, Aligned region: 776..803
AAA_22 [PF13401], Evalue: 3.10E-09, Aligned region: 229..316
AAA_22 [PF13401], Evalue: 3.10E-09, Aligned region: 348..386
AAA_22 [PF13401], Evalue: 3.10E-09, Aligned region: 615..639
AAA_22 [PF13401], Evalue: 3.10E-09, Aligned region: 679..711
AAA_17 [PF13207], Evalue: 1.90E-07, Aligned region: 60..75
AAA_17 [PF13207], Evalue: 1.90E-07, Aligned region: 230..278
AAA_17 [PF13207], Evalue: 1.90E-07, Aligned region: 458..500
AAA_17 [PF13207], Evalue: 1.90E-07, Aligned region: 617..653
Sigma54_activat [PF00158], Evalue: 2.60E-06, Aligned region: 224..257
Sigma54_activat [PF00158], Evalue: 2.60E-06, Aligned region: 617..736
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 214..253
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 617..635
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 230..363
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 616..698
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 230..251
AAA_19 [PF13245], Evalue: 1.70E-05, Aligned region: 615..639
Clp_N [PF02861], Evalue: 1.90E-05, Aligned region: 26..74
Clp_N [PF02861], Evalue: 1.90E-05, Aligned region: 117..128
AAA_29 [PF13555], Evalue: 7.30E-05, Aligned region: 222..246
AAA_29 [PF13555], Evalue: 7.30E-05, Aligned region: 611..643
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 230..255
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 481..494
AAA_18 [PF13238], Evalue: 0.00016, Aligned region: 619..642
NACHT [PF05729], Evalue: 0.00024, Aligned region: 230..257
NACHT [PF05729], Evalue: 0.00024, Aligned region: 617..643
Zeta_toxin [PF06414], Evalue: 0.00037, Aligned region: 230..250
Zeta_toxin [PF06414], Evalue: 0.00037, Aligned region: 483..502
Zeta_toxin [PF06414], Evalue: 0.00037, Aligned region: 611..657
SRP54 [PF00448], Evalue: 0.00066, Aligned region: 230..254
SRP54 [PF00448], Evalue: 0.00066, Aligned region: 616..650
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 281..311
Arch_ATPase [PF01637], Evalue: 0.0011, Aligned region: 616..629
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 231..251
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 618..639
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 715..735
MobB [PF03205], Evalue: 0.0035, Aligned region: 231..258
MobB [PF03205], Evalue: 0.0035, Aligned region: 616..642
AAA_30 [PF13604], Evalue: 0.0037, Aligned region: 216..252
AAA_30 [PF13604], Evalue: 0.0037, Aligned region: 460..495
AAA_30 [PF13604], Evalue: 0.0037, Aligned region: 616..643
DUF258 [PF03193], Evalue: 0.0044, Aligned region: 225..249
DUF258 [PF03193], Evalue: 0.0044, Aligned region: 615..629
AAA_25 [PF13481], Evalue: 0.0047, Aligned region: 230..254
AAA_25 [PF13481], Evalue: 0.0047, Aligned region: 614..635
AAA_23 [PF13476], Evalue: 0.0066, Aligned region: 230..245
AAA_23 [PF13476], Evalue: 0.0066, Aligned region: 464..496
AAA_23 [PF13476], Evalue: 0.0066, Aligned region: 615..651
Protein Sequence: 886 a.a.     [Download]
>gi|322432862|ref|YP_004210111.1| type VI secretion ATPase, ClpV1 family [Granulicella tundricola MP5ACTX9]
MSLNLKSLIAKLNDTTRSVLEASAGLCMSRTHYDIEIEHYLVKAMESSDNDIASILKHYGVDKSRLSKEL
DRALDNIKTGNARSPAFSPQLVKMLAEAWTVASIEYDAGSVRTGFTLLALLTHEDLARAVKEISRELQKI
EPEGLRKDFYTIVANSREVQASLKPTGGTGDATTSDGPAAGKGKTPNLDQYCVNLTGNAKAGKIDPVLGR
DAEVRQMIDILMRRRQNNPILTGEAGVGKTAVVEGLANRIVQGDVPPALQGVHLYSLDLALLQAGASVKG
EFEQRLKGLINEVKSSTEKIILFIDEAHTMIGAGGTAGQNDAANLLKPALARGELRTIAATTWSEYKKYF
EKDPALARRFQVVKVEEPSEEVCCTMLRGIVASLEKHHGLRILDEAIVATVKLSHRYIAGRQLPDKAVSV
LDTACARLALGQNSMPPQLEDVLRTIDSLEVQKRVLERENVIGASHGERVTEIDEKIAKNKATLEELKER
WEKEKALVSGIRTIQIELEAEPKKDEAAAAEARKKLGELEAELLALQGETGLMSVSVDAQICGAVISAWT
GIPLGKMMKDEISTVLTLAEHLKKRVIGQDHALAAIAQRILTSKANMDDPVKPIGVFMLVGPSGVGKTET
AIALADLLYGGEKNMITINMSEFQEAHTVSTLKGSPPGYVGYGEGGVLTEAVRRRPYSVVLLDECEKAHP
DVLELFFQVFDKGRMEDGEGREIDFRNTIILLTSNAATDTLMKLCADPETMPFSDGLLAAIKPELNKIFK
PAFLGRMITVPYFPVRDEALKQIIRLKLGKIQKRLRETHKVTMTYDDALLNEVASRCTEVESGARNVDNI
LSNTMLPEISRQMLGKLAEGETIESVAISVADGKMTYDWQEVAKAA
 
Nucleotide Sequence: 2661 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c13457-10797 Granulicella tundricola plasmid pACIX901, complete sequence
GTGAGTCTGAATCTGAAGTCCCTGATTGCGAAGTTGAACGATACGACCCGCAGCGTGCTCGAAGCGTCGG
CTGGTTTGTGCATGTCTCGCACGCACTATGACATCGAGATCGAGCACTACCTCGTGAAGGCGATGGAGAG
CAGCGATAACGATATCGCGTCGATCCTAAAGCATTACGGCGTGGATAAGTCGCGACTCTCGAAGGAGTTG
GACCGGGCGCTGGACAATATCAAGACGGGCAATGCGCGGTCCCCGGCGTTCAGCCCTCAGTTGGTGAAGA
TGTTGGCGGAGGCGTGGACTGTGGCGTCGATCGAGTACGATGCGGGCAGCGTACGTACGGGCTTTACGCT
GCTGGCGCTACTAACCCACGAGGACCTTGCACGCGCCGTGAAAGAGATCAGCCGCGAGCTACAGAAGATT
GAACCAGAGGGGCTGCGTAAGGACTTCTATACGATCGTGGCGAACTCGCGCGAGGTACAGGCGAGTCTGA
AGCCAACGGGCGGAACGGGCGACGCGACGACCAGCGATGGGCCTGCGGCGGGCAAGGGTAAGACTCCGAA
TCTGGATCAGTACTGCGTGAATCTGACCGGTAACGCGAAGGCCGGAAAGATCGACCCGGTGCTGGGACGC
GATGCTGAGGTTCGTCAGATGATCGACATCCTGATGCGCCGCCGGCAGAACAATCCGATCCTGACCGGTG
AGGCGGGTGTGGGTAAGACCGCTGTCGTGGAAGGGCTGGCGAACCGGATCGTTCAAGGTGATGTGCCCCC
GGCACTGCAGGGAGTTCACCTGTACAGCCTCGACCTGGCGTTGTTGCAAGCCGGCGCGAGCGTGAAGGGT
GAGTTCGAGCAGAGGCTCAAGGGACTGATCAACGAGGTGAAGTCTTCGACCGAGAAGATCATCTTGTTTA
TCGACGAAGCGCATACGATGATCGGCGCGGGCGGTACGGCGGGACAGAACGATGCGGCCAACCTGTTGAA
GCCGGCTCTCGCACGTGGCGAGTTGAGAACGATTGCTGCAACGACGTGGTCTGAGTACAAAAAGTACTTT
GAGAAAGATCCGGCTTTGGCGAGGCGCTTTCAGGTTGTGAAGGTCGAGGAGCCGAGCGAAGAGGTCTGCT
GCACGATGCTCCGTGGAATTGTTGCTTCGCTCGAGAAGCATCACGGACTGCGGATTCTGGATGAGGCGAT
TGTCGCGACGGTCAAGCTCTCGCACCGGTACATTGCCGGTCGCCAGTTACCGGATAAGGCGGTCAGCGTT
CTGGATACGGCTTGTGCACGCCTGGCTCTCGGACAGAACTCAATGCCTCCTCAGTTGGAAGACGTTCTGC
GGACGATCGACAGCCTTGAGGTGCAGAAGCGGGTGCTGGAGCGTGAGAACGTGATCGGCGCTAGCCATGG
CGAACGTGTGACCGAGATCGACGAGAAGATCGCCAAGAACAAGGCGACGCTTGAAGAGTTGAAGGAGCGC
TGGGAGAAAGAGAAGGCTCTCGTTTCCGGCATTCGCACGATCCAGATCGAGCTTGAGGCTGAACCGAAGA
AGGACGAGGCAGCCGCGGCAGAGGCACGGAAGAAGCTGGGCGAGCTTGAAGCAGAGTTGCTGGCACTGCA
GGGTGAAACCGGACTGATGAGCGTTTCGGTCGACGCTCAGATCTGCGGTGCGGTGATCTCGGCCTGGACG
GGCATTCCGCTGGGCAAGATGATGAAGGACGAGATCTCGACTGTGCTGACGCTTGCCGAACACCTGAAGA
AGCGTGTCATCGGACAGGACCATGCGCTGGCTGCAATCGCACAACGCATTCTCACCTCCAAGGCGAATAT
GGACGATCCGGTCAAACCGATTGGCGTCTTCATGCTGGTGGGACCGAGCGGCGTGGGCAAGACGGAGACG
GCGATCGCGCTGGCCGACCTGCTCTACGGCGGCGAGAAGAACATGATCACGATCAACATGTCGGAGTTCC
AGGAAGCACATACGGTATCGACGCTGAAGGGTTCGCCTCCGGGCTATGTGGGATACGGCGAGGGCGGTGT
GCTGACCGAGGCTGTGCGTCGCCGTCCTTACTCCGTTGTGCTGCTGGATGAGTGCGAGAAGGCTCATCCG
GACGTGCTGGAGCTGTTCTTCCAAGTGTTCGATAAGGGCCGGATGGAGGATGGTGAGGGCCGCGAGATAG
ATTTCCGGAACACAATCATCCTGCTGACGAGCAACGCAGCGACGGATACGTTGATGAAGCTGTGCGCCGA
TCCGGAGACGATGCCGTTCTCCGATGGACTGCTGGCGGCGATCAAGCCGGAGCTGAACAAGATCTTCAAG
CCGGCGTTCCTGGGCCGCATGATCACGGTGCCTTACTTCCCTGTTAGGGATGAAGCTCTGAAACAGATCA
TCCGGCTGAAGCTTGGCAAGATCCAGAAGCGGCTACGCGAGACGCACAAGGTCACGATGACGTATGACGA
TGCGTTACTGAACGAGGTGGCGTCGCGTTGCACGGAGGTCGAAAGCGGTGCGCGAAACGTGGACAATATT
CTGTCCAATACGATGCTGCCCGAGATCTCGCGGCAGATGCTCGGGAAACTGGCGGAGGGCGAGACGATTG
AGAGTGTCGCGATCTCCGTGGCGGACGGTAAGATGACGTACGATTGGCAGGAAGTGGCAAAGGCAGCCTG
A