SecReT6
Protein ID: 322432863
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_3998
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]13497..14549 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDE8X5R0
KEGG IDacm:AciX9_3998
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-94, Aligned region: 28..334
Protein Sequence: 350 a.a.     [Download]
>gi|322432863|ref|YP_004210112.1| type VI secretion protein [Granulicella tundricola MP5ACTX9]
MATESGHEGSALETDRAQFEAVRKMLDDEPFRVRFFQAVRMLQRMEKGRGTVGGFSQPQDETLRFSSLPT
FGFPPSEIYDLERMSSGQLKMTVQFMGLTSALSALPSMYTEQALTRIREKDRAMVEFFDIFNHRILSLFY
RAWEKHRYYIGYEAGLDDKLSLRLLDILGLGTEGLRNRARLSDKTYIYYAGLLGRHIRTADSLRQILEDF
FDVPVQINQFAGTWRSLPKENMTFLSGSGRMSEQLGLGVVTGEEVWDHHGRIQISLGPMRFDRYQQFLPG
ETGYNELVGWMQFYSDGAYETQVQLILDKQDVPECELDGQGQSTPRLGLVSWLKTRPRMTDAGEATYLLA
 
Nucleotide Sequence: 1053 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c14549-13497 Granulicella tundricola plasmid pACIX901, complete sequence
ATGGCCACCGAGAGCGGGCACGAAGGTTCTGCTTTAGAGACGGACCGGGCGCAGTTTGAGGCCGTCCGGA
AGATGCTTGATGACGAGCCGTTCCGCGTTCGCTTCTTCCAGGCTGTGCGGATGCTGCAGCGAATGGAGAA
GGGCCGAGGCACTGTAGGCGGTTTTTCGCAGCCGCAGGATGAGACTCTTCGCTTCTCTTCCCTTCCGACG
TTCGGGTTTCCGCCGAGTGAGATCTATGACCTGGAGCGGATGTCCTCCGGGCAATTGAAGATGACCGTGC
AGTTCATGGGACTGACTTCCGCCCTGTCTGCGCTGCCTTCGATGTACACGGAACAGGCGTTGACGCGGAT
TCGCGAAAAAGATCGCGCGATGGTTGAGTTTTTTGATATTTTCAACCATCGCATTCTTTCGCTTTTCTAC
CGCGCCTGGGAGAAGCACCGCTACTACATCGGGTATGAGGCTGGACTCGATGACAAGCTGAGCCTCCGTC
TGCTGGACATTCTGGGGCTGGGCACGGAAGGTCTTCGGAATCGTGCGCGGCTTTCCGATAAGACCTATAT
CTACTATGCCGGACTGCTGGGACGGCACATTCGTACGGCGGATTCGCTCCGTCAGATCTTGGAGGACTTC
TTCGACGTTCCGGTGCAGATCAACCAGTTTGCCGGGACGTGGCGTTCCCTGCCGAAGGAGAATATGACGT
TTCTTTCGGGAAGCGGGCGGATGAGCGAACAGCTTGGACTGGGCGTGGTGACGGGCGAAGAGGTCTGGGA
TCATCACGGCCGGATTCAGATTTCCTTGGGGCCAATGCGTTTTGACCGGTATCAACAGTTTTTACCGGGT
GAGACCGGATACAACGAGTTGGTCGGATGGATGCAGTTCTACTCCGACGGCGCGTACGAGACCCAGGTGC
AGTTGATTTTGGATAAGCAGGATGTGCCCGAGTGTGAGTTGGACGGGCAGGGCCAGAGTACCCCGCGGCT
TGGGCTTGTGAGCTGGTTGAAGACACGGCCGAGGATGACGGATGCAGGTGAGGCGACCTACCTTTTGGCT
TAG