SecReT6
Protein ID: 322432864
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_3999
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]14513..16360 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDE8X5R1
KEGG IDacm:AciX9_3999
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.90E-196, Aligned region: 5..615
Protein Sequence: 615 a.a.     [Download]
>gi|322432864|ref|YP_004210113.1| type VI secretion protein [Granulicella tundricola MP5ACTX9]
MSEELLEYYERELNYLRQMGGDFARRYPRVASRLLLTGDSCEDPHVERLLEGFAFMAARVHRRIDDDFPE
ISESLLNMIYPAYLRPIPSMTIVECLSDPGQGKKTAGTKIPRGSAMVTKATVDGMPCRFESAYEVELWPF
SVVEAEWRQVERLQYPVRASGEVQAVTAARLKLKCFQDVEFEGLPLSTLRFHLAGDASVVYNLYEMISAN
CIEIILRDPKNRTRTISLEPGQIRMVGFEKDEAVIPHERRSAEGHRLLQEYFALPEKFLFFDLSGLEALG
ETGFGDEAEIIFLFSRFERSDRQQVMELGVSARTFRLGCTPVINLFPQTAEPILLTQTKHEYTVIPDGRH
AAMMEVFSIDEVIAANPKLRQSVTLEPVNAHRYETREQKDTAYWTATRNVSQLGEREPSVLTISVVDLNG
QLKSPDADVLTVRTTCSNFDLPSRFNFGTTESDMEAVGHAAAKVVNVLRRPTASADPPQGKGQVWRLVSL
LSLNYLSLTEDGKTALQEILRLHNFTDSQHLENHIGSIQKMTSGPHFALVLSDYGLVPARGTEVHLELDE
QQFVGGGVYLFAAVLDRFLAGYASINSFSQLSVRTNLRKEVMRTWPPRAGTKVLL
 
Nucleotide Sequence: 1848 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c16360-14513 Granulicella tundricola plasmid pACIX901, complete sequence
ATGTCGGAAGAGTTGCTGGAGTATTACGAGCGCGAGCTGAACTACCTGCGGCAGATGGGGGGCGACTTTG
CGCGCCGCTATCCGCGGGTGGCAAGCCGTTTGCTGCTCACGGGCGACTCCTGCGAAGATCCGCATGTGGA
AAGGCTGCTGGAAGGATTTGCGTTCATGGCGGCGCGGGTTCATCGGCGCATCGATGATGACTTTCCGGAG
ATCAGCGAATCGCTGCTGAACATGATCTACCCGGCCTACCTGCGGCCAATTCCCTCGATGACGATTGTGG
AGTGTCTGTCCGATCCTGGGCAGGGGAAGAAGACGGCGGGTACGAAGATTCCGCGCGGCTCCGCGATGGT
GACGAAGGCGACGGTAGATGGGATGCCGTGCCGGTTCGAATCAGCTTATGAGGTTGAGCTTTGGCCGTTC
TCGGTGGTGGAGGCGGAGTGGCGGCAGGTGGAGCGGCTCCAGTATCCGGTGCGGGCTTCAGGCGAGGTGC
AAGCGGTGACGGCTGCGCGGCTGAAGCTGAAGTGCTTTCAGGACGTGGAGTTTGAAGGGCTTCCGCTTTC
GACGCTTCGGTTTCATCTGGCGGGCGACGCAAGCGTCGTCTACAACCTGTACGAGATGATCTCGGCGAAC
TGCATTGAGATCATTTTGCGCGATCCGAAGAACCGGACCCGAACGATCTCGCTGGAGCCCGGGCAGATCC
GAATGGTGGGTTTCGAAAAGGATGAGGCGGTGATTCCGCATGAGCGGCGATCGGCTGAAGGACATCGTCT
GCTGCAGGAGTACTTTGCGCTGCCGGAGAAGTTCCTGTTCTTCGACCTGAGCGGGCTGGAGGCGCTGGGG
GAAACAGGATTTGGGGACGAGGCGGAGATTATCTTTCTGTTCTCTCGGTTTGAGCGGTCAGACCGGCAGC
AGGTGATGGAGTTGGGGGTCAGTGCACGAACGTTCCGGCTGGGATGCACGCCGGTGATCAACCTGTTTCC
GCAGACGGCCGAGCCAATTTTGCTGACGCAGACCAAGCATGAGTATACGGTGATTCCCGATGGCCGGCAC
GCGGCGATGATGGAGGTCTTCAGCATCGACGAGGTGATTGCGGCGAACCCGAAGCTGCGGCAGTCGGTCA
CGCTGGAGCCAGTGAACGCGCATCGGTATGAGACCCGGGAGCAGAAGGACACGGCCTACTGGACGGCGAC
GCGGAATGTGAGTCAGCTTGGAGAGCGCGAGCCTTCCGTACTGACGATCTCCGTGGTGGATCTGAACGGG
CAACTGAAGAGCCCGGATGCGGACGTGCTGACGGTACGGACGACCTGCTCGAACTTCGATTTGCCGTCAC
GATTCAATTTCGGTACGACCGAGAGCGACATGGAGGCTGTGGGTCATGCGGCGGCGAAGGTCGTGAACGT
GCTGCGGCGGCCCACGGCGAGTGCCGATCCACCGCAGGGCAAAGGTCAAGTTTGGCGGCTGGTCTCTTTG
CTTTCGTTGAACTACCTGTCTCTGACGGAAGATGGGAAGACGGCGCTGCAGGAGATTCTGCGGCTGCACA
ACTTTACGGATTCGCAGCACCTGGAGAACCACATCGGCAGCATTCAGAAGATGACCTCCGGGCCACACTT
CGCGCTGGTGCTTTCCGACTACGGACTGGTGCCGGCGCGCGGTACCGAGGTTCACCTGGAGCTTGATGAA
CAGCAGTTCGTTGGCGGCGGCGTTTACCTGTTTGCGGCGGTTCTGGATCGATTTCTGGCGGGATATGCCT
CCATCAACAGCTTCTCGCAGCTTTCCGTGCGGACGAATCTCAGGAAGGAGGTAATGCGGACATGGCCACC
GAGAGCGGGCACGAAGGTTCTGCTTTAG