SecReT6
Protein ID: 322432865
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4000
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]16364..16825 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE8X5R2
KEGG IDacm:AciX9_4000
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.50E-19, Aligned region: 32..132
Protein Sequence: 153 a.a.     [Download]
>gi|322432865|ref|YP_004210114.1| type VI secretion system lysozyme-like protein [Granulicella tundricola MP5ACTX9]
MAKSKAENLVTQSLLDRLCDVDDWPTTRQQSMRVYRESIKRDVEYLLNSRRPPIEDINLYPRAAASVINY
GLPDIHSYSESAGDQSALMTAMLQTLRRFEPRIQGVRVFVSRGEAMTRSLQFRIEGRIQFDTQVENIEFD
TVLELTRGEYEVK
 
Nucleotide Sequence: 462 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c16825-16364 Granulicella tundricola plasmid pACIX901, complete sequence
GTGGCCAAGAGCAAAGCAGAAAATCTCGTAACGCAATCGCTGCTGGACCGGCTGTGCGATGTGGATGACT
GGCCTACGACGCGGCAGCAGTCTATGCGAGTTTATCGTGAATCGATCAAGCGGGATGTGGAGTATCTGCT
GAACTCGCGGAGGCCACCGATTGAGGATATCAACCTCTATCCGAGGGCGGCGGCTTCAGTGATCAATTAT
GGGTTGCCGGATATTCATTCGTATTCAGAGTCCGCCGGAGACCAGAGCGCACTGATGACGGCGATGCTAC
AGACGTTGCGGAGATTTGAGCCGAGAATTCAGGGCGTGCGGGTGTTTGTTTCGCGCGGGGAGGCGATGAC
GCGGAGTCTTCAGTTTCGGATTGAGGGGCGCATTCAGTTCGACACGCAGGTTGAGAATATCGAGTTCGAC
ACGGTGCTGGAGTTGACGCGCGGTGAGTATGAGGTGAAGTAG