SecReT6
Protein ID: 322432866
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4001
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]16855..18714 [-]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDE8X5R3
KEGG IDacm:AciX9_4001
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.80E-13, Aligned region: 57..113
ImpA-rel_N [PF06812], Evalue: 8.80E-13, Aligned region: 387..405
Protein Sequence: 619 a.a.     [Download]
>gi|322432866|ref|YP_004210115.1| type VI secretion-associated protein, ImpA family [Granulicella tundricola MP5ACTX9]
MPLREDLLEPIAGANPSGTNLYYDKVFDQIKEARIEDDDSGSAGAWERTPKKADHVLVIKLASETLAKRT
KDLRLAGWLIESHLKREGIALLPGCLDLILKLQDQFWDTVFPEIDDDGDLGLRVTAIEAPVNRIASFVKG
LPILKNGFGQSKYVESRKVGYEKAADTKEKREARQDAINQGQVTAEDFDIAFAATPKTFFVATEEALTAS
LLLIDEMGVFQEDKYGDDYPAMNKLVTSLEEVKQAVSGLLNERRKTEPDIEIAPEPEPEPEPEPVVVVAA
PIAVAVESQAAPAAVPVVQTAPLKAAGFGGVPTTPEQAHTAVMEGALFLHGQAPQSPVPYLVCSGLRFGE
MRAQGAVYELNFAVAPPTETRQALKRLASESNWNDLLTLGLKTLGEPCARTWLDLQRYLWRGATGLGANA
LAAAIVSTVRGVLIDLPEIRGWSLDDDTPAANAETQQWIDAAILPPAPVIEEEKPTVEAPVVAAPPPMGA
GPEQMKGPDIYEQATILLKSGKTGEAITLLVRDAELQPSGRTRFQRRVQVAQLCLVADQGAIAYPVLVEL
SKEIERRGLETWETGEMLAHPLGLLLKCLDKRGSPAEEKEVVFERLCRLDPQAALGRLA
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c18714-16855 Granulicella tundricola plasmid pACIX901, complete sequence
ATGCCTCTGCGTGAGGATCTGCTCGAGCCGATCGCCGGTGCCAATCCTTCCGGGACCAACCTCTACTACG
ACAAAGTCTTCGATCAGATTAAGGAAGCCCGTATCGAAGATGACGATAGCGGTTCGGCGGGTGCGTGGGA
ACGCACGCCGAAGAAGGCCGACCACGTCCTTGTGATCAAGCTGGCGAGCGAGACGCTTGCCAAGCGAACG
AAGGATCTAAGGCTTGCGGGCTGGCTGATCGAGTCGCACCTGAAGCGAGAGGGAATTGCACTGCTTCCCG
GGTGCCTCGATCTGATATTGAAGCTGCAAGATCAGTTCTGGGATACGGTTTTTCCCGAGATCGATGACGA
CGGCGACCTGGGGCTGCGCGTCACCGCGATTGAAGCTCCTGTGAACCGTATTGCCAGCTTCGTCAAAGGG
CTTCCCATTCTGAAGAACGGCTTTGGGCAGTCGAAGTACGTTGAATCCCGCAAGGTGGGCTATGAGAAGG
CTGCCGACACCAAGGAAAAGCGCGAGGCTCGCCAGGACGCCATCAACCAGGGCCAGGTCACGGCCGAAGA
TTTCGATATCGCCTTTGCGGCTACTCCAAAGACATTTTTTGTTGCAACGGAAGAGGCCCTCACGGCTTCC
CTTCTCCTGATCGATGAGATGGGGGTGTTTCAGGAGGACAAGTACGGCGACGATTATCCTGCGATGAACA
AGCTCGTCACGTCGCTTGAGGAGGTGAAGCAGGCTGTCTCCGGGCTATTGAATGAACGGCGTAAGACGGA
ACCGGATATTGAGATCGCTCCGGAACCTGAGCCCGAGCCTGAACCGGAACCTGTAGTGGTCGTTGCCGCT
CCGATCGCGGTTGCTGTCGAAAGCCAAGCTGCCCCTGCAGCCGTACCGGTAGTGCAGACGGCTCCGTTGA
AAGCCGCTGGATTCGGTGGGGTTCCGACGACTCCCGAGCAGGCACACACGGCGGTGATGGAAGGCGCCCT
GTTTCTGCACGGTCAGGCTCCACAATCGCCGGTTCCTTACCTGGTCTGCTCCGGTTTGCGGTTTGGAGAG
ATGCGCGCGCAGGGGGCGGTTTATGAGCTGAACTTTGCCGTCGCCCCTCCTACAGAGACGCGCCAGGCTT
TGAAGCGGCTGGCGAGCGAGAGCAACTGGAACGATCTTCTGACACTAGGTCTCAAAACACTGGGAGAGCC
CTGTGCGCGGACGTGGCTCGATCTGCAACGGTATCTATGGCGCGGCGCGACAGGGCTGGGAGCGAATGCG
CTGGCTGCAGCGATCGTCAGCACCGTGCGTGGCGTGCTGATCGATCTGCCGGAGATTCGCGGGTGGTCGC
TGGATGATGACACTCCTGCGGCGAACGCGGAGACACAACAATGGATCGATGCGGCGATCCTGCCTCCGGC
ACCGGTGATCGAAGAAGAAAAGCCCACGGTTGAAGCGCCGGTTGTGGCTGCTCCACCGCCGATGGGTGCC
GGACCAGAACAGATGAAGGGACCCGACATCTATGAGCAGGCTACGATTCTGCTGAAGAGCGGCAAGACAG
GCGAGGCCATTACCCTGCTGGTGCGGGACGCTGAACTGCAACCGAGTGGACGCACCCGTTTCCAACGCCG
TGTGCAGGTTGCACAACTCTGCCTGGTTGCGGATCAGGGAGCGATTGCTTATCCGGTTCTGGTAGAGCTT
TCCAAGGAGATCGAACGGCGCGGGCTGGAGACGTGGGAGACAGGCGAGATGCTAGCGCACCCCCTGGGTC
TGCTGCTCAAGTGCCTAGACAAGCGAGGCAGCCCGGCAGAGGAGAAGGAAGTCGTGTTTGAACGTTTGTG
TCGGCTCGATCCGCAGGCGGCATTGGGCAGGCTTGCTTAG