SecReT6
Protein ID: 322432867
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4002
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]18701..19432 [-]
Productvirulence protein SciE type
NoteTagJ
UniProt IDE8X5R4
KEGG IDacm:AciX9_4002
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.20E-32, Aligned region: 104..229
Protein Sequence: 243 a.a.     [Download]
>gi|322432867|ref|YP_004210116.1| virulence protein SciE type [Granulicella tundricola MP5ACTX9]
MTALDLYKKGELQEAIKVLGDEVRSNPLDTKRRTFLFELLCFAGNYDRAEKQLDFLAGDGGKTAAGALMY
RSALHAERTRQDLFAKKAYPELNASVEPLTGMWNGQAFSDLRDADPRIGANLEVFIAGSYTWIPMKYMEQ
IEIEKPESLRDLIWARARIETSKAFRLQDLGEVLIPVLSPFSYQQADDAVKLGRMTVWESADGEAEVPFG
QRMMLIDGEEVPLLELNSIDWERIAEEVADASA
 
Nucleotide Sequence: 732 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c19432-18701 Granulicella tundricola plasmid pACIX901, complete sequence
ATGACGGCGTTGGACCTGTACAAAAAAGGTGAGTTGCAAGAAGCGATCAAGGTGCTTGGTGACGAGGTCA
GGAGCAATCCTCTCGACACCAAGCGCCGCACCTTTCTGTTCGAGCTTCTCTGCTTCGCCGGCAACTACGA
CCGCGCCGAGAAGCAGTTGGATTTTCTGGCAGGAGATGGCGGGAAAACGGCCGCCGGCGCTTTGATGTAT
CGCAGTGCCCTGCATGCGGAGAGAACGCGGCAGGATCTCTTCGCGAAGAAGGCTTATCCAGAGTTGAATG
CCTCCGTCGAGCCACTGACTGGAATGTGGAACGGTCAGGCTTTCTCCGATCTGCGAGATGCCGACCCACG
GATCGGCGCAAATCTTGAGGTCTTTATTGCGGGCAGCTACACCTGGATTCCCATGAAGTACATGGAGCAG
ATCGAGATCGAGAAGCCCGAGAGCCTGCGTGATCTGATCTGGGCTCGGGCGCGCATTGAGACGAGCAAGG
CCTTCCGCCTACAGGACCTGGGCGAGGTTCTGATCCCTGTTCTGTCGCCGTTCTCTTATCAGCAGGCGGA
CGATGCGGTGAAGCTCGGCCGGATGACGGTATGGGAGTCCGCGGATGGTGAGGCGGAGGTTCCGTTCGGC
CAGCGCATGATGCTGATCGACGGTGAGGAAGTTCCTCTGCTGGAGTTGAACAGCATCGATTGGGAACGGA
TCGCGGAGGAAGTCGCCGATGCCTCTGCGTGA