SecReT6
Protein ID: 322432868
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4003
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]19440..19916 [-]
Producthypothetical protein
NoteTssD
UniProt IDE8X5R5
KEGG IDacm:AciX9_4003
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.50E-33, Aligned region: 6..133
Protein Sequence: 158 a.a.     [Download]
>gi|322432868|ref|YP_004210117.1| hypothetical protein AciX9_4003 [Granulicella tundricola MP5ACTX9]
MAVDFFFKLADIPGESVDSKHPNEISVMSFSWGASQTTSVSGSGGSGAGKASLADLSIMKNYDVASGPMY
KALLLGTHIATGVLTAVKSGGDGSPFLTISLGEVFITSVQVSGSSEVPMESVSFSYNTISTEYAQQDETG
KLNVKAAINYNLKQNLVS
 
Nucleotide Sequence: 477 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c19916-19440 Granulicella tundricola plasmid pACIX901, complete sequence
ATGGCCGTAGATTTTTTTTTCAAACTCGCAGATATCCCCGGTGAGTCCGTGGATTCCAAGCACCCCAACG
AAATCAGCGTGATGTCTTTCAGCTGGGGGGCGAGCCAGACCACCTCGGTCTCGGGTTCGGGCGGATCAGG
AGCCGGCAAGGCGTCTCTTGCGGACCTGAGCATCATGAAGAACTACGACGTAGCGAGCGGTCCGATGTAC
AAGGCCCTCCTGCTCGGCACCCACATTGCAACCGGCGTGCTGACGGCCGTGAAGTCCGGCGGCGACGGCA
GCCCGTTCCTGACGATCTCTCTGGGCGAGGTTTTTATCACCAGCGTGCAGGTCAGCGGATCAAGCGAAGT
TCCGATGGAGAGCGTGTCCTTCAGCTACAACACGATCTCGACCGAGTATGCACAGCAGGATGAGACCGGC
AAGCTGAATGTGAAGGCTGCCATCAACTACAACCTGAAGCAGAACCTCGTCAGCTAG