SecReT6
Protein ID: 322432869
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4004
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]19998..21491 [-]
Producttype VI secretion protein EvpB
NoteTssC
UniProt IDE8X5R6
KEGG IDacm:AciX9_4004
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.10E-187, Aligned region: 71..493
DUF3386 [PF11866], Evalue: 0.0013, Aligned region: 53..128
DUF3386 [PF11866], Evalue: 0.0013, Aligned region: 136..151
Protein Sequence: 497 a.a.     [Download]
>gi|322432869|ref|YP_004210118.1| type VI secretion protein EvpB [Granulicella tundricola MP5ACTX9]
MSSAANPLASASTAEAVETGEPSLLDQIVAQGRFSREAGDLERGKDLVKEFVSQVLEGQMTLSKDAEATI
SARIAQLDRLISIQLNEVIHHPSFQKLEATWRGIKYLMDQSETNDMLKIKVLNASKKDLLRDLQRAPEFD
QSALFKKVYEEEFGVFGGAPFAAMVGDYEFGRGPEDLELLEKIGQVASAAHAPFLSAAAPGLMNLSDYTQ
LGAPRDMSKIFDSTEYAKWKSFRQSDDSRYVALTLPHILMRQPYGQDTKQIEAFAYEEAVDGRDHSKYLW
GNAAFGLAARMTNSFARSGWCSAIRGVEGGGLVEGLTAHNFTTDEGDVALKCPTEVTITDRREKELADQG
FVPLVHCKGTDKAAFFSVQTVNKPKLYDKPEANANARLSAQLPYIMAMSRFAHYLKAMMRDKIGSAMSRV
EAEKFLNQWVNQYVLADDTGSAAAKAKRPLREARIEVMSVPGNAGALRAVAFMRPHFQLDELTVSLRLVA
DLPAPAK
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c21491-19998 Granulicella tundricola plasmid pACIX901, complete sequence
ATGAGTAGTGCAGCGAACCCGCTGGCGAGCGCCAGCACCGCAGAAGCAGTCGAGACGGGCGAGCCTTCCC
TTCTTGATCAGATCGTCGCGCAGGGCCGTTTCAGCCGCGAGGCTGGCGATCTAGAGCGAGGCAAAGATCT
GGTGAAGGAGTTCGTCAGCCAGGTGCTCGAAGGACAGATGACGTTGAGCAAGGATGCCGAGGCGACGATC
AGCGCACGCATCGCGCAGCTTGACCGTCTGATCTCGATCCAGTTGAACGAGGTGATTCATCACCCTTCGT
TCCAGAAGCTGGAAGCGACGTGGCGCGGCATCAAGTACCTGATGGATCAGAGCGAGACGAACGACATGCT
CAAGATCAAGGTGCTGAACGCGTCCAAGAAAGACCTGCTGCGCGATCTTCAGCGTGCACCGGAGTTCGAT
CAGAGCGCCTTATTCAAGAAGGTCTACGAAGAGGAGTTCGGCGTATTCGGCGGCGCTCCGTTCGCGGCGA
TGGTCGGCGATTACGAGTTTGGCCGTGGTCCTGAAGATCTGGAGCTGCTCGAGAAGATCGGGCAGGTCGC
ATCCGCGGCGCATGCTCCGTTCCTTTCCGCTGCCGCTCCTGGCTTGATGAACCTGAGCGACTACACACAG
CTCGGCGCTCCACGCGATATGTCGAAGATCTTCGACAGCACCGAGTATGCGAAGTGGAAGTCGTTCCGTC
AGTCCGACGACTCCCGCTACGTTGCGTTGACGCTTCCGCACATCCTGATGCGCCAGCCGTACGGGCAGGA
TACGAAGCAGATCGAAGCGTTTGCGTATGAGGAAGCGGTGGACGGCCGCGACCACTCGAAGTATCTGTGG
GGCAATGCGGCGTTCGGCCTGGCTGCACGCATGACGAACTCGTTTGCGCGGTCCGGCTGGTGCTCGGCGA
TCCGCGGCGTGGAAGGCGGGGGCCTGGTCGAAGGACTGACGGCCCATAACTTCACGACCGACGAGGGCGA
TGTCGCGCTGAAGTGTCCGACCGAGGTGACGATCACCGACCGTCGTGAAAAAGAGCTTGCCGATCAGGGT
TTTGTTCCCCTGGTTCATTGCAAGGGGACGGACAAGGCCGCGTTCTTCAGCGTCCAGACCGTCAACAAGC
CGAAGCTGTACGACAAGCCGGAGGCGAATGCCAATGCCCGGCTTTCGGCCCAGCTTCCGTACATCATGGC
GATGTCTCGTTTCGCACATTACCTCAAGGCGATGATGCGCGATAAGATCGGCAGCGCGATGAGCCGTGTC
GAGGCAGAGAAGTTCCTAAATCAGTGGGTCAACCAGTACGTGCTTGCGGATGACACAGGATCTGCGGCGG
CAAAGGCAAAACGGCCTTTACGCGAGGCTCGTATTGAGGTCATGTCGGTTCCTGGAAATGCGGGTGCGCT
GCGCGCAGTCGCGTTTATGCGGCCGCATTTCCAACTGGATGAGTTGACCGTTTCTCTGAGGCTGGTGGCG
GATCTGCCGGCTCCCGCGAAGTAA