SecReT6
Protein ID: 322432870
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4005
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]21484..22005 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDE8X5R7
KEGG IDacm:AciX9_4005
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.20E-56, Aligned region: 9..165
Protein Sequence: 173 a.a.     [Download]
>gi|322432870|ref|YP_004210119.1| type VI secretion protein [Granulicella tundricola MP5ACTX9]
MAESTQHKLDRVRSPRVHITYDVEVGNAIELKELPFVMGVLGDLTGQPETPLAALKDRKFVEINPDNFDT
VLKGMQPHLAYSVDNKLSDDPNAGQVKVNLHFESMDDFSPENVAKQVKPLKELLDLRTRLSDLRGTLQGN
DKLDQMLFDAVSNTEDRNKLRAEVGTTPEGGNE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|322432858|ref|NC_015057.1|:c22005-21484 Granulicella tundricola plasmid pACIX901, complete sequence
ATGGCTGAGAGTACGCAACACAAACTCGATCGTGTGAGATCGCCGCGCGTTCATATCACGTATGACGTTG
AAGTCGGCAATGCAATTGAACTTAAGGAATTGCCGTTCGTGATGGGTGTGCTGGGCGATCTGACCGGCCA
GCCTGAGACTCCGCTGGCCGCATTGAAAGACCGCAAGTTCGTGGAGATCAACCCGGACAACTTTGACACG
GTTTTGAAGGGGATGCAGCCGCACCTGGCATACTCTGTTGACAACAAGCTGAGCGACGACCCGAATGCAG
GACAGGTGAAGGTGAATCTTCACTTCGAGAGCATGGACGACTTTTCGCCGGAGAACGTGGCGAAGCAGGT
CAAGCCGCTGAAGGAGCTTCTGGATCTGCGCACGCGGCTCTCCGATCTGCGCGGCACGCTGCAGGGCAAC
GACAAGCTGGACCAGATGCTGTTCGATGCGGTTTCGAACACGGAAGATCGAAACAAGCTTCGTGCGGAAG
TCGGCACGACCCCGGAGGGTGGAAATGAGTAG