SecReT6
Protein ID: 322432871
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4006
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]22432..23787 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDE8X5R8
KEGG IDacm:AciX9_4006
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-124, Aligned region: 19..446
Protein Sequence: 451 a.a.     [Download]
>gi|322432871|ref|YP_004210120.1| type VI secretion protein [Granulicella tundricola MP5ACTX9]
MRQLQPVIWSKGTFLSPQHLQSQERFVEDTVRFYLDSLVSKSWGFLKIQIDAKALTEGTLTISVATGIFP
DALPIDVPASDPAPPSRVLDECFRDGRETCMFYLAIPQYLQGGMNVSLQRGRVSTRYLAQLQMTRDENSG
SNEKPVQVARKNLQLLAEGENLEGSVLLACARVLKTETGMYHLDPTYVPSLIDVHGNETLTSIIRGLIEL
LVTRSSQLSGSRRQKNQTLADFTASDVANFWLLYTINTHLPGLRHYLESSSVQPEMLFGDLSDLAGALTA
FSTQIDPRDLPRYDHDNLGPCFIELDRLLRIMLETVVPTNVVSIPLNLTRETIYAASIDKDAWFDNSRFY
LAVSADMRDTDLIDRIPKLTKVCSATHIEMLVRQALPGIKLTHVEQPPRAIPVKLRYQYFSIERSGTAWE
AVQRARNFAVYAPSDLLNPQMELIILLPKAN
 
Nucleotide Sequence: 1356 bp     [Download]
>gi|322432858|ref|NC_015057.1|:22432-23787 Granulicella tundricola plasmid pACIX901, complete sequence
ATGCGACAGTTGCAGCCCGTCATCTGGTCCAAAGGCACCTTCCTGTCCCCGCAGCACCTGCAGTCGCAGG
AACGCTTCGTCGAAGACACCGTGCGCTTCTATCTCGATTCGCTTGTCTCAAAATCCTGGGGCTTCCTCAA
GATCCAGATCGACGCCAAGGCCCTCACCGAAGGCACGCTCACCATCTCTGTTGCAACCGGCATCTTCCCT
GACGCTCTCCCCATCGACGTCCCCGCTTCCGATCCCGCGCCACCCTCCCGAGTCCTTGACGAATGTTTCC
GCGACGGACGCGAGACCTGCATGTTCTACCTTGCCATCCCGCAGTACCTGCAAGGCGGCATGAACGTCTC
ACTCCAGCGCGGCCGCGTCAGCACCCGCTACCTCGCACAGCTTCAGATGACTCGCGACGAAAACAGCGGC
AGCAATGAAAAGCCTGTACAGGTCGCCCGTAAAAATCTCCAGCTCCTCGCTGAAGGCGAAAACCTTGAAG
GCTCCGTCCTCCTGGCCTGCGCGCGCGTCCTCAAGACCGAAACGGGAATGTACCACCTCGACCCAACCTA
CGTTCCATCTCTCATAGACGTACACGGCAACGAAACGCTCACCAGCATCATCCGCGGCCTGATCGAGCTC
CTCGTCACCCGTTCCAGCCAGCTCTCCGGCAGCCGCCGTCAAAAGAACCAGACCCTCGCCGACTTCACCG
CCTCGGACGTCGCCAACTTCTGGCTCCTCTACACCATCAACACCCACCTCCCCGGCCTCCGCCACTACCT
CGAATCCTCCAGCGTCCAGCCCGAGATGCTCTTCGGCGATCTCTCCGACCTCGCCGGCGCGCTCACCGCC
TTCTCCACCCAGATCGATCCCCGCGACCTCCCGCGCTACGACCACGACAACCTCGGCCCCTGCTTCATCG
AGCTCGACCGTCTCCTCCGCATCATGCTTGAGACCGTCGTCCCCACCAACGTCGTCTCCATCCCCCTCAA
CCTCACGCGCGAGACCATCTACGCCGCCTCCATCGACAAGGACGCCTGGTTCGACAACTCCCGCTTCTAC
CTCGCCGTCTCCGCCGACATGCGCGACACCGACCTCATCGACCGCATCCCCAAGCTCACCAAGGTCTGCT
CCGCCACCCACATCGAGATGCTCGTCCGCCAGGCCCTCCCCGGCATCAAGCTCACCCACGTCGAGCAGCC
TCCCCGCGCCATCCCCGTCAAGCTCCGCTACCAGTACTTCAGCATCGAGCGCAGCGGCACCGCCTGGGAG
GCCGTACAACGCGCCCGCAACTTCGCCGTCTACGCCCCCTCAGACCTCCTAAATCCCCAGATGGAACTCA
TCATCCTCCTGCCTAAAGCCAACTGA