SecReT6
Protein ID: 322432874
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4009
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]28657..30015 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDE8X5S1
KEGG IDacm:AciX9_4009
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-112, Aligned region: 19..447
Protein Sequence: 452 a.a.     [Download]
>gi|322432874|ref|YP_004210123.1| type VI secretion protein [Granulicella tundricola MP5ACTX9]
MKFLSRVVWSEGMHLGPHHFQTQSRYFEDSLWFLSAGLRRNPWGLISLSLDTEAIRNGNVVLRYASGIFP
DGLVFEIPDSDPAPPAVSLKDLFSPTDSEITLFLTVPKRSSRGLDCDTATLKSNAARYSSADRTITDDTS
GQDEYTVAFGNKNLTLVSQAQLTPDAISFPLARIFRDGKGGFAVDPDFIPPALRISANENLLTLLKRLIE
TLNERIKTVSRGKKREGQFEIGSSSLDVANYWFLHALCSAIPSLQQHLDAKHSHPEELYLDLVRLSGALC
TFSLESNPSDIPPYSHLHLQSVFHALDAHIRRHLEIVVPSNTLTLDFTKSEPYVFVANVNDERCFRRARW
IFGIRSSLAESDLLRLTPHLVKICSAEGVTKLVQRALPGLELLHLSVPPSSMSAEADMHYFSISSAGACW
QHILQTKRVGIYVPGDIRDAVFEITVILEANA
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|322432858|ref|NC_015057.1|:28657-30015 Granulicella tundricola plasmid pACIX901, complete sequence
ATGAAGTTCCTCTCTCGCGTCGTCTGGTCGGAGGGAATGCATCTTGGCCCACATCACTTCCAGACTCAGA
GCCGCTATTTCGAAGACTCCCTCTGGTTCCTCTCAGCAGGCCTTCGCCGCAATCCCTGGGGCCTCATCAG
CCTCTCCCTCGACACCGAAGCCATCCGCAACGGCAACGTCGTCCTCCGTTACGCCTCCGGCATCTTCCCG
GACGGCCTTGTCTTCGAGATCCCCGACAGCGATCCCGCACCCCCCGCCGTCAGCCTCAAAGACCTCTTCT
CCCCCACCGACAGCGAGATCACCCTCTTCCTCACCGTCCCCAAGCGCTCCTCTCGCGGCCTCGACTGCGA
CACCGCCACCCTGAAATCCAACGCCGCCCGCTACTCCTCCGCCGACCGCACCATCACCGACGACACCAGC
GGCCAGGACGAGTACACCGTAGCCTTCGGCAATAAAAATCTCACCCTCGTCAGCCAGGCCCAGCTCACCC
CCGACGCTATCTCCTTCCCCCTTGCCCGCATCTTCCGCGATGGCAAAGGCGGCTTCGCCGTCGATCCCGA
CTTCATCCCTCCCGCCCTCCGCATCTCCGCCAACGAGAACCTCCTCACCCTCCTCAAGCGCCTCATTGAA
ACCCTCAACGAGCGCATCAAGACCGTCTCCCGCGGCAAAAAGCGTGAAGGCCAGTTCGAGATCGGCAGCT
CCTCCCTCGACGTCGCCAACTACTGGTTCCTCCACGCCCTCTGCTCCGCCATCCCATCCCTCCAGCAGCA
TCTCGACGCCAAGCACAGCCACCCCGAGGAGCTCTACCTCGATCTCGTCCGCCTCTCCGGCGCCCTCTGC
ACCTTTTCGCTCGAGTCCAATCCATCCGACATCCCCCCCTACTCCCACCTCCATCTCCAGTCCGTCTTCC
ACGCCCTCGACGCCCACATCCGCCGCCATCTTGAGATCGTCGTCCCCTCCAACACCCTCACCCTCGACTT
CACCAAGTCCGAGCCCTACGTCTTCGTCGCCAACGTCAACGACGAGCGTTGCTTCCGCCGCGCCCGCTGG
ATCTTCGGCATCCGGTCCTCGCTCGCCGAGTCCGACCTCCTCCGCCTTACCCCGCACCTCGTCAAGATCT
GCTCCGCCGAAGGCGTCACCAAGCTCGTCCAGCGCGCCCTCCCCGGACTCGAGCTCCTCCACCTCTCTGT
CCCTCCCTCCTCCATGTCGGCTGAGGCGGACATGCACTACTTCAGCATCAGCTCCGCCGGAGCCTGCTGG
CAGCACATCCTCCAGACCAAGCGCGTCGGCATCTATGTGCCCGGTGACATCCGCGACGCCGTCTTTGAAA
TCACCGTCATCCTTGAGGCCAACGCATGA