SecReT6
Protein ID: 322432875
SecReT6 ID506
T6SS typei4b
Gene symbol-
Locus tagAciX9_4010
StrainGranulicella tundricola MP5ACTX9
Repliconplasmid pACIX901 [GenBank: NC_015057] [Browse all T6SS(s) in this replicon]
Location [Strand]30012..30746 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDE8X5S2
KEGG IDacm:AciX9_4010
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.00E-32, Aligned region: 17..222
Protein Sequence: 244 a.a.     [Download]
>gi|322432875|ref|YP_004210124.1| DotU family type IV/VI secretion system protein [Granulicella tundricola MP5ACTX9]
MSTAATIPQAPPAARTNSLALSFQDVITVVLRMRYGAQRIPDAAAFRVSIRKMIAASVQEVRSLGYSDAT
SHMALYAIIGFLDESVLNSQDPVFADWSRRPLQEEMFGGHFAGETFFRQVADLLNAPESTEVADTLELHA
ICLLLGYRGKYAFGEGGEISGILSRIRDKIIRIRGPLALARLSAVPEVKIVAKRDKWLTSLYLAAACLIV
LTIVLFAVYTLTLGSGLGSIRSAALFTPFTRLSL
 
Nucleotide Sequence: 735 bp     [Download]
>gi|322432858|ref|NC_015057.1|:30012-30746 Granulicella tundricola plasmid pACIX901, complete sequence
ATGAGCACCGCCGCCACTATTCCGCAGGCCCCACCCGCCGCCCGCACCAACTCACTCGCCCTCTCCTTCC
AGGACGTCATCACCGTCGTCCTCCGCATGCGTTACGGAGCCCAGCGAATCCCCGACGCCGCAGCCTTCCG
CGTCTCTATCCGCAAGATGATCGCGGCCTCCGTCCAGGAGGTCCGCTCTCTCGGTTACTCCGATGCCACC
AGCCACATGGCCCTCTACGCCATCATCGGTTTCCTCGATGAAAGTGTCCTCAACTCCCAGGACCCCGTCT
TCGCCGATTGGTCCCGCCGCCCTCTCCAGGAAGAGATGTTCGGCGGCCACTTCGCCGGCGAGACCTTCTT
CCGCCAGGTCGCAGACCTCCTCAACGCCCCCGAATCCACGGAAGTCGCCGACACCCTCGAGCTCCACGCC
ATCTGCCTCCTCCTTGGCTATCGTGGCAAGTACGCCTTCGGCGAAGGCGGCGAGATAAGCGGTATTCTGT
CCCGCATCCGCGACAAGATCATCCGCATCCGTGGCCCGCTCGCCCTCGCCCGCCTCAGTGCCGTACCAGA
GGTCAAAATCGTCGCCAAACGCGATAAGTGGCTCACCTCCCTGTATCTCGCCGCCGCCTGCCTCATCGTG
TTGACCATCGTGCTCTTCGCCGTCTACACCCTCACCCTCGGCTCCGGCCTCGGCAGCATTCGCAGCGCTG
CCCTCTTCACTCCCTTTACGAGGCTCTCCCTGTGA