SecReT6
Protein ID: 32265736
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0237
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]227242..228036 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7VJK6
KEGG IDhhe:HH0237
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 264 a.a.     [Download]
>gi|32265736|ref|NP_859768.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MQAENTNSHHNLIESGFNEITLSNLKEQEHIYLQAQRDYEELIKHNFLQTIHNNKESQVEGTYNERIKKI
HTQTIDLAKIVSIGGEYNTNVALSKDTIVGLSHTLNVGVDNKVRIAKKSSEYVGEDKEVEIGGNLNTSIE
QDESRNVGGNKREIIQGTLDIQSIKEYNLSTQSQMNFNAKDNILFFGKESTSFETQKELSFIADNTDMES
KSNFTATAGNQILHQVGDTSITAKGDCVIIKAGGVEVVIDSKGLVVKGGEVKAE
 
Nucleotide Sequence: 795 bp     [Download]
>gi|32265499|ref|NC_004917.1|:c228036-227242 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
TTGCAAGCAGAGAATACAAACTCTCATCACAATCTCATAGAATCTGGATTCAATGAAATCACGCTCTCCA
ATCTCAAAGAACAAGAACACATCTATCTTCAAGCACAAAGAGATTATGAAGAACTCATTAAGCATAACTT
TCTCCAAACCATACATAACAATAAAGAATCTCAAGTAGAGGGAACTTATAATGAAAGGATTAAAAAGATT
CATACTCAAACCATAGATTTAGCAAAGATTGTAAGTATTGGAGGAGAATATAATACCAATGTAGCTTTAT
CTAAAGATACCATTGTAGGATTAAGTCATACTTTAAATGTAGGAGTAGATAACAAAGTAAGGATTGCAAA
GAAGAGTAGTGAATATGTAGGAGAGGATAAGGAGGTGGAGATAGGGGGGAATCTCAATACAAGTATAGAA
CAAGATGAGAGTAGGAATGTAGGGGGGAATAAGAGGGAAATCATACAAGGGACATTAGACATACAGAGTA
TAAAAGAATATAATCTTTCTACTCAATCCCAAATGAATTTTAATGCTAAAGATAATATCTTATTCTTTGG
CAAAGAATCTACTTCATTTGAAACACAAAAAGAACTTTCTTTTATAGCAGATAATACTGATATGGAATCT
AAGAGTAATTTTACTGCTACAGCTGGCAACCAAATCCTTCACCAAGTAGGAGATACTTCAATTACTGCTA
AGGGAGATTGTGTTATTATTAAAGCAGGTGGAGTAGAAGTAGTGATAGATTCTAAAGGATTAGTTGTTAA
AGGTGGGGAGGTAAAGGCGGAGTGA