SecReT6
Protein ID: 32265741
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0242
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]231618..234416 [-]
Producthypothetical protein
NoteTssI
UniProt IDQ7VJK1
KEGG IDhhe:HH0242
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-20, Aligned region: 182..415
Phage_base_V [PF04717], Evalue: 1.40E-13, Aligned region: 543..645
DUF2345 [PF10106], Evalue: 0.003, Aligned region: 387..412
DUF2345 [PF10106], Evalue: 0.003, Aligned region: 838..917
DUF3540 [PF12059], Evalue: 0.0032, Aligned region: 613..623
DUF3540 [PF12059], Evalue: 0.0032, Aligned region: 828..902
Protein Sequence: 932 a.a.     [Download]
>gi|32265741|ref|NP_859773.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MSAFLSLDINSITFTITKAHIRESLQSPFHITCNGFIESFYADIFSATFASLGKTNSPSHTIQSHTQDTD
FASSAPPYSFALDQPFNLQLLQDNFALLYISNPYGNTNYHSALSISLGNTSTPIKSYKGIITHIEYLGSK
SNVSLDTNNTINTITDITNTSQQKTLSSLDIPTPKSINHRHFFTFTLTSPLIRLSLNKANRIYTDKTPLD
ILKDILTAYTPQLCKQIDFSSLSQIDNPLEIITQYEESDLDFITRLAHNNGIYFYEDNDTLYVCHHTPYT
PIPLTKVPFNPNVKTHNNLNEPCIFALTHSHHIHTKQFNFFSNDANNPQINTYMYSKYIDKQSPDIATHS
TSNDTSLAQEDMNNPYNYTASMQSVFIPNVSFTYQANIKSLCSNQAQHTANTQALMNAQSNIYTLCLAQR
LYIESKNKSLLGNNIQDNKTQEFINEYTIIALEQTLINESILADTLPSHQQANDSNISRFKDTYSNLITL
LPSNLSYMPTPKPKPNPPSLMQGIVVGEEYIKAKNIKEANASIIKQSNTLYTDNFGRVKVRLHAFMAQAL
LTDNDIHTTPNTNNTKHSNNTHLEDDLYTLNTHTAFLRVASPIASASSGFYHTPRVGDEVLISYLNNDID
MPIIIGSLYNPSNPALPPLPLNAHQTSLSARTLNNSSALQAENTNSHHNLIESGFNEITLSNLKEQEHIY
LQAQRDYEELIKHNFLQTIHNNKESQVEGTYNERIKKIHTQTIDLAKIVSIGGEYNTNVALSKDTIVGLS
HTLNVGVDNKVRIAKKSSEYVGEDKEVEIGGNLNTSIKQDESRNVGGNKREVVEGDSDISIEKKFNIQTQ
GEIAIHSNENIHLSSPQSLSLESDRAAVMVADNITMIADSNYLLNANNEATIQVSDTSIVAKSDSIVIKA
GGVEVVIDSKGLVVKGGEVKAE
 
Nucleotide Sequence: 2799 bp     [Download]
>gi|32265499|ref|NC_004917.1|:c234416-231618 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGAGTGCTTTTCTTTCTTTGGATATTAACTCTATCACCTTTACCATCACCAAAGCCCATATTAGAGAAA
GTTTGCAGTCTCCTTTTCATATTACTTGTAATGGTTTTATAGAATCCTTTTATGCAGATATATTTTCTGC
TACTTTTGCTTCTTTGGGTAAAACAAACTCTCCCTCACACACAATCCAATCTCATACCCAAGATACCGAT
TTTGCATCATCTGCTCCCCCTTATTCTTTTGCATTAGACCAACCTTTCAATCTCCAGCTATTGCAAGATA
ATTTTGCTCTATTATATATTTCTAATCCCTATGGCAACACAAACTATCATAGTGCTCTTTCTATCTCTTT
AGGTAATACTTCTACCCCTATTAAATCATATAAGGGTATCATTACACATATAGAGTATTTAGGTTCTAAA
TCTAATGTTTCCTTAGATACAAATAACACAATCAACACTATTACTGACATAACCAATACTTCTCAACAAA
AGACACTCTCTTCCTTAGATATACCTACACCTAAATCTATAAACCATAGACATTTCTTTACCTTTACACT
CACTTCTCCTCTCATAAGACTTTCACTCAATAAAGCAAATAGAATCTATACAGATAAAACACCTTTAGAC
ATACTCAAAGATATACTCACTGCTTATACTCCACAATTATGCAAACAAATAGATTTTTCTTCTCTTAGCC
AAATTGATAATCCTTTAGAGATTATCACCCAATATGAAGAATCTGATTTAGATTTCATCACACGATTAGC
TCATAATAATGGTATATACTTTTATGAAGACAATGATACCTTATATGTATGTCATCACACACCCTATACT
CCTATTCCTCTCACTAAAGTCCCTTTTAATCCTAATGTAAAAACACATAATAATCTTAATGAACCCTGTA
TTTTTGCTCTCACACATTCTCATCATATACACACAAAACAATTTAACTTCTTCAGCAATGATGCAAACAA
TCCTCAAATCAATACTTATATGTATTCAAAATATATTGACAAACAATCCCCAGATATTGCCACTCATTCT
ACATCAAATGATACTTCTCTAGCACAAGAAGATATGAATAATCCTTATAACTATACTGCCTCTATGCAAA
GTGTATTTATACCCAATGTGAGTTTTACCTATCAAGCGAATATAAAGTCTCTTTGCTCTAATCAAGCCCA
ACATACTGCCAATACTCAAGCTCTTATGAACGCTCAAAGCAATATCTATACACTCTGTTTAGCTCAAAGA
TTATATATAGAATCTAAAAATAAATCTCTTTTAGGAAATAATATTCAAGATAATAAAACGCAAGAGTTTA
TAAATGAATATACTATCATAGCATTAGAGCAAACCCTTATAAACGAATCTATTCTTGCAGATACTTTACC
CTCTCATCAACAAGCCAATGATAGCAACATCTCTCGGTTCAAAGATACTTATAGTAATCTTATTACTCTC
TTGCCTTCAAACCTATCTTATATGCCTACACCCAAGCCCAAACCAAACCCTCCATCTCTTATGCAAGGTA
TAGTTGTAGGAGAAGAGTATATAAAAGCCAAGAATATTAAAGAGGCTAATGCAAGTATCATCAAACAGAG
CAACACGCTTTATACAGATAACTTTGGCAGGGTAAAAGTAAGGCTGCATGCCTTTATGGCACAAGCTTTA
CTCACGGATAATGATATACACACAACACCCAATACAAACAATACCAAACATTCAAACAATACTCATTTAG
AAGATGATTTATATACTCTTAATACACACACAGCTTTTCTTAGAGTAGCCTCTCCTATTGCAAGTGCAAG
TTCAGGTTTTTATCATACTCCAAGAGTGGGAGATGAAGTATTAATAAGTTACTTAAATAATGACATAGAT
ATGCCCATCATTATAGGCAGTCTCTACAATCCAAGTAATCCTGCCTTACCTCCCCTCCCTTTAAATGCTC
ATCAAACAAGTTTAAGTGCAAGAACTCTTAATAATAGCAGTGCATTGCAAGCAGAGAATACAAACTCTCA
TCACAATCTCATAGAATCTGGATTCAATGAAATCACGCTCTCCAATCTCAAAGAACAAGAACACATCTAT
CTTCAAGCACAAAGAGATTATGAAGAACTCATTAAGCATAACTTTCTCCAAACCATACATAACAATAAAG
AATCTCAAGTAGAGGGAACTTATAATGAAAGGATTAAAAAGATTCATACTCAAACCATAGATTTAGCAAA
GATTGTAAGTATTGGAGGAGAATATAATACCAATGTAGCTTTATCTAAAGATACCATTGTAGGATTAAGT
CATACTTTAAATGTAGGAGTAGATAACAAAGTAAGGATTGCAAAGAAGAGTAGTGAATATGTAGGAGAGG
ATAAGGAGGTGGAGATAGGGGGGAATCTCAATACAAGTATCAAACAAGATGAGAGTAGGAATGTAGGGGG
GAATAAGAGAGAGGTGGTGGAGGGGGACAGCGATATAAGCATTGAGAAAAAGTTTAATATTCAAACACAA
GGTGAAATTGCTATTCATTCTAATGAGAATATTCATTTGTCATCTCCTCAATCTTTGAGTTTAGAATCTG
ATAGAGCTGCTGTAATGGTTGCAGACAATATAACAATGATTGCAGATTCTAATTATCTCCTTAATGCTAA
TAATGAAGCAACAATTCAAGTGAGCGATACTTCTATTGTAGCCAAAAGTGATTCTATCGTTATTAAAGCT
GGTGGAGTAGAAGTAGTCATAGATTCTAAAGGATTAGTCGTTAAAGGTGGGGAGGTAAAGGCAGAGTGA