SecReT6
Protein ID: 32265742
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0243
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]234543..235052 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ7VJK0
KEGG IDhhe:HH0243
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.60E-37, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|32265742|ref|NP_859774.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MAQPAYIKIEGVTQGLISSGASTQESIGNRYQAGHEDEIMAQEISHIVTVPTDTQSGQPSGQRVHRPFIF
TCSLNKAVPLLYNALTKGERLNNVEVHWFRTSIGGGAEHYFTTKLEDAIITDIDLIMPNAQDTSNNNKTE
LFRVSLNYRKIIWEHVVAGTSGSDDWRNA
 
Nucleotide Sequence: 510 bp     [Download]
>gi|32265499|ref|NC_004917.1|:c235052-234543 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGGCGCAGCCAGCATATATTAAAATTGAAGGTGTTACACAAGGACTTATTTCTAGTGGGGCTTCTACGC
AAGAGAGCATAGGTAATCGTTACCAAGCAGGACACGAAGATGAAATTATGGCTCAAGAGATTTCTCATAT
TGTAACTGTTCCCACAGATACACAAAGCGGACAACCATCAGGTCAAAGGGTGCATAGACCCTTTATTTTT
ACCTGTTCTCTCAATAAAGCTGTTCCTTTACTTTACAATGCCCTCACAAAGGGTGAAAGATTAAACAATG
TAGAAGTACATTGGTTTAGGACATCAATAGGTGGTGGAGCAGAACATTACTTCACTACAAAATTAGAAGA
TGCTATTATTACAGACATAGACCTTATTATGCCAAATGCACAAGATACAAGCAATAATAACAAAACTGAG
CTCTTTAGGGTTTCTCTTAATTATCGAAAAATTATTTGGGAACATGTTGTTGCAGGAACGAGCGGAAGTG
ATGACTGGAGAAATGCTTAA