SecReT6
Protein ID: 32265743
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0244
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]235149..236144 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ7VJJ9
KEGG IDhhe:HH0244
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.50E-46, Aligned region: 52..313
Protein Sequence: 331 a.a.     [Download]
>gi|32265743|ref|NP_859775.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MNFTFYRLIKMLLVSLNREQIFLRSARSLGHAYKEVDILQYHGMADLESKDMLPLEASSVKAMEKLPQNI
SSKMHTESFVEVFSYFFGLLGQSSPLPYYMLDNFAKNEDDGEGFSLFFDFFNNYLLWLFYDSISLRGYHR
SFETDFSDRISFVLLKLLGFSDTTSAKAYLPFAPLILSLRRPKAYIEKILAHNFHLHDRISIVENIPQAI
RINKNQQNSLGFKNVTLGKSFLLGSTIYSYQNKILLRIKDLHYQEALDYFPHHKQHNKLRESVIFLTNNE
FAIDVRLDMQYNPKMDFRLGDIARATLGFGLLLNKKKANFAQCSMLMTLCE
 
Nucleotide Sequence: 996 bp     [Download]
>gi|32265499|ref|NC_004917.1|:c236144-235149 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGAATTTTACTTTTTATCGGCTAATAAAAATGCTCTTGGTTTCTTTGAATAGGGAGCAAATCTTTTTAC
GTAGTGCTAGGAGTTTGGGACATGCGTATAAAGAAGTTGATATATTACAATATCATGGTATGGCAGATTT
AGAGTCGAAAGATATGCTTCCACTTGAGGCTTCATCTGTAAAAGCTATGGAAAAATTACCTCAAAATATA
TCTTCCAAAATGCATACTGAATCTTTCGTGGAAGTCTTTAGCTATTTTTTTGGATTGCTAGGGCAATCTT
CACCTCTGCCTTATTATATGCTTGATAATTTTGCAAAAAATGAAGATGATGGCGAAGGCTTTAGTCTTTT
TTTTGATTTTTTTAATAATTATCTCTTATGGCTATTTTATGATAGCATATCACTTAGAGGTTATCATCGC
TCATTTGAGACAGATTTTAGCGATAGAATTTCTTTTGTATTGTTGAAACTTTTAGGTTTTAGTGATACAA
CAAGTGCAAAGGCATATCTTCCATTTGCACCTCTTATTTTAAGCCTAAGGAGACCAAAAGCTTATATTGA
GAAAATTTTGGCACATAATTTTCATTTGCACGATAGAATTTCTATTGTCGAGAATATTCCACAAGCCATT
CGTATCAATAAGAATCAACAGAATAGTTTAGGATTTAAAAATGTTACTCTTGGCAAAAGTTTTCTACTAG
GTAGCACAATATATTCCTATCAAAATAAAATATTACTCCGCATCAAGGATTTGCATTATCAGGAAGCCCT
AGATTATTTTCCACATCATAAGCAACACAATAAACTTAGAGAGAGTGTAATTTTTCTCACCAACAATGAA
TTTGCCATTGATGTTCGTTTAGATATGCAATATAACCCCAAAATGGATTTTAGGCTCGGCGATATTGCGA
GGGCTACTCTTGGTTTTGGGTTATTATTAAATAAAAAAAAGGCGAATTTTGCACAATGTAGTATGTTAAT
GACACTATGTGAGTAA