SecReT6
Protein ID: 32265744
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0245
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]236141..237856 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ7VJJ8
KEGG IDhhe:HH0245
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.60E-142, Aligned region: 5..571
Protein Sequence: 571 a.a.     [Download]
>gi|32265744|ref|NP_859776.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MKNIHYFRKELDYLHKMREIFVNKYPKLAPFLSHNSNDPDVERIIESLALLTSKIHEELDGNIPLIAESL
INILAPNYTNSLPSMCIQDFALKPESKECKVFIPRHTSLKSTPINQVQCEFKTIYDVCLHPLKISDMSLT
NEGKQSVFCLDIVSTNKFFKIADMDIHFLQIYLGSEVYSANTLLLWLLCYLQEIVIVCADTLTSFKIPCD
SLETTGFDKNESMFSNGDVGFSAFTLLQELLFLPEKFAFVRIKNLEILKECQSEKMTFKFIFKKELPKDT
LPKANQFSLFSTPIVNLFSTQTEPILTDHTRNGYRIFIDRAHLNAYSVIQVLKVKAHNSDSGRRILKNYN
SFERFEFVDKGNDFYAISNKQDANGEHYKEISIYSNQSRRETLSIDVLCSNNNLPNGLQIGSINEIVGYQ
DVLTRNLMLPTKSQHRSIDNATLWDFIATLSFNYQSITHKESFLALLHTYSFNIDKPKNLYEIISESLQK
IESKPAYNVNGFITLRGMQITLYIDDSKFYCLGEAYKIGLVLAHFFSSFVSINSFCEVSLCCTTSNTSFS
YSIIYGNKALL
 
Nucleotide Sequence: 1716 bp     [Download]
>gi|32265499|ref|NC_004917.1|:c237856-236141 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
GTGAAAAATATTCATTATTTCCGTAAAGAGCTTGATTATTTGCATAAAATGAGGGAAATTTTTGTTAATA
AATATCCCAAACTTGCCCCATTTTTATCCCACAATAGTAATGATCCAGATGTGGAACGTATTATAGAATC
TTTAGCGTTATTAACATCTAAGATTCACGAAGAGCTTGATGGCAATATTCCCCTGATTGCAGAATCTTTG
ATTAACATTCTTGCACCCAATTACACAAACTCGTTGCCATCAATGTGCATACAGGACTTTGCACTTAAGC
CAGAAAGCAAAGAATGCAAGGTTTTTATTCCTAGACATACAAGTCTTAAATCTACTCCAATAAATCAAGT
GCAATGTGAATTTAAAACTATCTATGATGTTTGTCTGCATCCTCTTAAAATAAGCGATATGTCGCTTACT
AACGAAGGGAAGCAGAGTGTATTTTGCCTTGATATTGTAAGCACAAACAAATTTTTTAAAATAGCAGATA
TGGATATTCATTTTTTACAGATTTATCTTGGCAGTGAGGTTTATAGTGCCAATACATTACTTTTATGGCT
TTTATGTTATTTGCAAGAAATTGTTATTGTCTGTGCTGATACTCTCACATCTTTTAAGATTCCTTGTGAT
TCTTTAGAGACTACGGGTTTTGACAAAAATGAGAGTATGTTTAGTAATGGCGATGTAGGCTTTAGTGCTT
TTACACTTTTACAAGAATTGCTTTTTTTGCCAGAAAAATTTGCATTTGTGAGAATAAAAAATCTAGAAAT
ACTAAAAGAATGTCAAAGTGAAAAGATGACTTTTAAATTTATTTTCAAAAAAGAATTGCCTAAAGATACC
CTTCCAAAAGCCAATCAGTTTTCGCTATTTAGCACGCCCATTGTTAATCTTTTTTCTACCCAGACAGAGC
CGATTCTTACTGACCATACACGAAATGGGTATAGAATATTTATCGATAGGGCGCATCTTAACGCATATTC
TGTGATACAGGTATTGAAAGTTAAGGCTCATAATAGCGACTCAGGAAGACGGATATTAAAAAATTACAAT
AGTTTTGAGCGATTTGAATTTGTAGATAAGGGAAATGATTTTTATGCTATTTCAAATAAGCAAGATGCAA
ATGGAGAGCATTATAAAGAAATTAGTATTTATAGTAATCAATCTCGCAGAGAAACACTTTCCATTGATGT
TTTATGTAGCAACAACAATCTTCCAAATGGTTTGCAGATAGGCTCAATCAATGAGATTGTAGGATATCAA
GATGTCCTTACACGTAATCTTATGTTACCTACAAAATCGCAACATAGAAGTATTGATAATGCTACATTGT
GGGATTTTATCGCTACCCTTTCTTTTAATTATCAAAGTATAACGCATAAAGAGAGCTTCTTAGCATTGTT
GCATACATACAGCTTTAATATTGATAAACCAAAAAATCTTTACGAAATAATAAGTGAATCCTTACAAAAG
ATAGAATCCAAGCCTGCTTATAATGTCAATGGATTTATTACATTAAGAGGTATGCAAATTACCCTATATA
TTGATGATTCAAAGTTTTATTGTTTAGGTGAGGCATATAAGATAGGCTTAGTGCTTGCACACTTTTTTTC
TTCTTTTGTTAGTATCAATTCTTTTTGCGAGGTATCCTTGTGCTGTACAACAAGTAATACATCTTTTAGC
TATTCTATCATCTATGGCAATAAGGCATTATTATGA