SecReT6
Protein ID: 32265746
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0247
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]238319..239791 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ7VJJ6
KEGG IDhhe:HH0247
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.50E-176, Aligned region: 63..488
Protein Sequence: 490 a.a.     [Download]
>gi|32265746|ref|NP_859778.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MSGASANTQTSIKELSIIDSIMQTSRYSKEDESYNIAKMGVVEFITEIVKTDSAENKINKYTLDEMIAHI
DDIISRQMDEILHNEQIQQLESTWRGLYFLVERTNFQENIKINLFDVTKQEALEDFEANPDITTATLYKR
IYSSEYGQFGGEPVGAILGDYALNASTPDMNFLSKMSSIAAMSHAPFLTSMSAGFFGLDNYAELPKIQDL
KALLEGPQYVKWRTFRENEDSKYAGLLVTRFLTRSPYEPQENPIKKFNYKENVHNSHNHLLWGNTIYAFA
TRLTDSFANYRWCGNIIGPKAGGAVKDLPTYIYESFGTTQSKIPTEVLITDRCEYELAESGFIAFTLRRD
SNNAVFFSANAALKPKIFPNTPEGKEAETNYRLGTQLPYIFLVSRLAHYLKVLQREEIGSWKERADIENG
LNEWMRQYVSDQENPPAEVRSRRPFRGAKVLVSEIEGEAGWYRINLNVRPHFKFMGANFELSLVGKLDRE
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|32265499|ref|NC_004917.1|:c239791-238319 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGAGTGGTGCATCAGCAAATACACAAACTTCAATAAAAGAGCTATCTATCATTGATAGTATAATGCAGA
CAAGTAGATATTCAAAGGAAGATGAAAGTTATAATATTGCCAAAATGGGTGTGGTGGAATTTATCACAGA
AATAGTCAAAACTGATAGTGCAGAAAATAAAATCAACAAATACACGCTTGATGAAATGATAGCGCATATT
GATGATATTATCTCACGTCAAATGGACGAGATATTACACAACGAACAGATTCAGCAATTAGAATCTACAT
GGAGAGGTTTATATTTTTTAGTAGAACGCACTAATTTTCAAGAAAATATAAAAATTAATTTGTTTGATGT
AACTAAACAAGAGGCTTTAGAGGATTTTGAGGCAAATCCAGATATTACAACAGCTACATTATATAAACGT
ATTTATTCTTCTGAATATGGACAATTTGGTGGCGAGCCTGTAGGTGCAATTCTGGGTGATTATGCCTTGA
ATGCTTCTACGCCTGATATGAATTTTCTTTCTAAGATGTCTTCTATTGCGGCTATGAGCCATGCTCCATT
TTTAACTTCTATGAGTGCTGGTTTTTTTGGGCTTGATAATTATGCGGAACTTCCCAAGATACAGGATTTA
AAAGCACTTTTAGAGGGTCCGCAATATGTAAAATGGCGCACCTTTAGGGAAAATGAAGATTCTAAGTATG
CTGGTTTATTGGTTACACGTTTTCTTACTCGATCTCCTTATGAGCCACAAGAAAATCCTATAAAGAAATT
TAATTACAAGGAAAATGTGCATAACTCGCATAATCACTTGCTATGGGGAAATACTATTTATGCTTTTGCT
ACGCGATTGACTGATAGTTTTGCAAATTATCGCTGGTGTGGAAATATTATAGGACCTAAGGCTGGCGGTG
CTGTAAAAGATTTGCCTACTTATATTTATGAAAGCTTTGGCACTACGCAATCTAAGATACCAACGGAGGT
GCTTATCACAGATAGATGTGAGTATGAGCTTGCAGAATCTGGCTTCATAGCCTTTACGTTGCGACGTGAT
AGCAATAATGCAGTATTTTTCTCCGCAAATGCCGCATTAAAGCCAAAAATTTTTCCAAATACGCCTGAAG
GAAAAGAGGCAGAGACAAATTATAGGCTTGGTACGCAGTTACCCTATATATTTTTAGTTTCTCGCCTTGC
TCATTATCTTAAGGTATTGCAAAGAGAAGAAATTGGGAGCTGGAAAGAAAGAGCAGATATAGAGAATGGC
TTAAATGAGTGGATGAGGCAATATGTTTCAGATCAAGAGAATCCTCCCGCAGAGGTTCGAAGTAGGCGAC
CATTTAGAGGCGCCAAAGTTCTTGTAAGCGAGATAGAAGGGGAAGCAGGTTGGTATAGAATAAATTTAAA
TGTACGACCCCACTTTAAATTTATGGGAGCAAACTTTGAACTTTCTTTGGTGGGGAAACTTGACAGAGAA
TAA