SecReT6
Protein ID: 32265747
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0248
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]239839..240336 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ7VJJ5
KEGG IDhhe:HH0248
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.20E-54, Aligned region: 5..156
Protein Sequence: 165 a.a.     [Download]
>gi|32265747|ref|NP_859779.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MAENSTPPKERINITYRSKTNGQNPDVELPLKLMVMGNFTGGNDVPFDEREVVSINKHNFNQVMQKMNIG
THVSVKNVLKQDADELSVNLKFEGLGDFSPDSIATQVPELNKLLQLREALVALKGPMGNIPDFRKALLEA
LKDKDTKEKLLLEIKENQSTDENKK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|32265499|ref|NC_004917.1|:c240336-239839 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGGCAGAAAATTCTACTCCGCCAAAAGAGCGGATAAATATCACATATCGTTCAAAGACAAATGGGCAGA
ATCCTGATGTAGAGCTTCCTTTGAAGCTAATGGTTATGGGTAATTTTACAGGAGGCAATGATGTGCCGTT
TGATGAACGAGAGGTTGTGTCTATTAATAAACACAATTTTAATCAAGTAATGCAAAAAATGAATATAGGC
ACACATGTAAGTGTAAAAAATGTTCTCAAGCAAGATGCAGATGAATTATCTGTAAATCTTAAGTTTGAAG
GGTTGGGTGATTTTTCACCAGACAGTATTGCTACTCAAGTGCCAGAGCTAAACAAATTGCTTCAACTACG
TGAAGCCCTTGTAGCATTGAAGGGACCAATGGGCAATATTCCAGATTTTAGAAAAGCACTCTTGGAAGCC
CTCAAGGATAAAGATACAAAAGAGAAGCTTTTGCTAGAGATTAAAGAGAATCAATCTACAGATGAAAATA
AAAAGTGA