SecReT6
Protein ID: 32265748
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0249
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]240524..241060 [+]
Producthypothetical protein
NoteTssJ
UniProt IDQ7VJJ4
KEGG IDhhe:HH0249
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.90E-21, Aligned region: 20..146
Protein Sequence: 178 a.a.     [Download]
>gi|32265748|ref|NP_859780.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MRYIQLYISFCILACFMGLAISGCSSPVKIQAFNQADSNLNNRGDNVPVTLIIYQLKDISKFKQSSIQDL
STRGNVVLGRDIVDFIKVQVPPNEIDVPVAEFAKKEGKYIGVLALFANPQDKKQKFYKKLNRVFSNKIEL
NIATEGIMQHKKSKQSQGKDTKADGTAGENNIKDLFNE
 
Nucleotide Sequence: 537 bp     [Download]
>gi|32265499|ref|NC_004917.1|:240524-241060 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGCGATATATCCAGCTTTATATTTCCTTTTGCATTCTCGCTTGCTTTATGGGGCTAGCTATTAGTGGGT
GCAGCTCACCTGTTAAGATACAGGCTTTCAATCAGGCAGATTCTAACCTTAATAATCGTGGCGATAATGT
GCCTGTTACGCTCATTATTTATCAGCTCAAGGATATTAGTAAATTCAAGCAATCTTCCATACAAGATTTA
AGCACACGTGGAAATGTTGTCCTTGGAAGGGACATTGTAGATTTTATCAAGGTGCAAGTGCCGCCAAATG
AAATTGACGTGCCTGTTGCAGAATTTGCAAAAAAAGAGGGTAAATATATCGGCGTGTTAGCTCTTTTTGC
CAATCCGCAGGATAAAAAACAAAAATTCTATAAAAAGCTGAATCGTGTCTTTTCAAACAAAATCGAGCTT
AATATTGCCACTGAAGGCATTATGCAACACAAAAAAAGTAAGCAAAGTCAAGGTAAAGATACAAAGGCTG
ATGGCACTGCTGGAGAAAACAATATAAAGGATTTGTTCAATGAATAG