SecReT6
Protein ID: 32265749
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0250
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]241053..242432 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ7VJJ3
KEGG IDhhe:HH0250
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-120, Aligned region: 19..457
Protein Sequence: 459 a.a.     [Download]
>gi|32265749|ref|NP_859781.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MNSKLKVAWYNGMHIDKIHFEQQERFLEHIIHTKTSRLVSNLYGVFDVSFSTDMLNLGKIALTQISGITQ
DGSVFNAPDDDLLPEVLELPPNMSSPIITLKIPTYSDATADMSLKNTFPNSKYIVSNVPTTSKIHDDVQD
YIHTNTEEISYQQEKVSLALGSLRLKLGILGDKSPNELEIPIAKVKNIYSHSKKIELDEKFIPTSIDICS
NAFIKSFLEEMLFSIKQHKESFTQIFRGIDQTKNTLDFSTYLSLNLLKKYTLIFSYLVNKEKLHPETLYE
KLVEFQADLLTISHNDAQDEFIPYEHNDLSAVFIPLSNNIRLLFANVTSPKYAMAQVIDNGNGFYDCIFD
NASMLQDGELFLAVSSSLPMQTLLETFSTQSKIHTQATIKSIVASQLKGLHIEAIPSIPSALPHLSGYVY
FKLDKQDFIFTHFAKQNVISLYMTNNITKPDIKLWALFN
 
Nucleotide Sequence: 1380 bp     [Download]
>gi|32265499|ref|NC_004917.1|:241053-242432 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGAATAGTAAGCTTAAGGTCGCTTGGTATAATGGTATGCACATTGATAAAATCCATTTTGAGCAACAAG
AACGATTTTTAGAACATATTATCCATACAAAAACCTCTCGACTTGTATCTAATCTTTATGGTGTATTTGA
TGTAAGTTTTTCTACCGATATGCTCAATTTGGGCAAAATAGCCCTTACACAAATTAGTGGAATTACACAA
GATGGTAGCGTGTTTAATGCGCCAGATGATGATTTATTACCTGAAGTTTTGGAGTTGCCGCCCAATATGT
CTTCACCAATTATTACGCTAAAAATCCCTACATATTCAGACGCTACTGCTGATATGTCTTTAAAAAATAC
TTTTCCAAACTCCAAGTATATTGTAAGCAATGTACCTACAACTTCCAAGATTCACGATGATGTGCAAGAT
TACATACATACTAACACAGAAGAAATCTCTTATCAGCAAGAAAAAGTTTCTCTTGCATTGGGGAGTTTGC
GGCTAAAGCTTGGTATCCTTGGAGACAAATCACCAAATGAACTAGAAATACCCATAGCAAAAGTGAAAAA
CATCTATTCTCATAGCAAAAAAATAGAGCTTGATGAAAAATTTATCCCCACCTCTATTGATATTTGCAGT
AATGCCTTTATAAAAAGTTTTCTAGAAGAAATGCTCTTTTCCATCAAGCAACACAAAGAAAGCTTCACGC
AAATTTTTAGAGGCATAGACCAAACCAAAAATACGCTTGATTTTAGCACCTATTTATCGCTCAATCTCCT
CAAAAAATACACGCTTATCTTTTCTTATCTTGTCAATAAAGAAAAACTACACCCAGAGACATTATATGAA
AAACTTGTAGAATTTCAAGCTGACTTACTTACCATAAGTCATAATGATGCACAAGATGAATTTATACCCT
ACGAGCACAATGATTTAAGTGCGGTTTTCATTCCGCTTAGTAATAATATCCGCCTCCTCTTTGCTAATGT
TACCTCACCCAAATATGCAATGGCACAAGTCATAGACAATGGCAATGGATTCTACGATTGCATATTTGAT
AATGCTTCTATGCTGCAAGATGGGGAATTATTCTTAGCAGTAAGCTCCTCTCTACCTATGCAAACGTTAC
TTGAAACCTTTAGCACACAGAGTAAAATACATACCCAAGCCACTATTAAAAGCATTGTTGCCTCACAGCT
TAAAGGACTGCATATAGAGGCAATCCCCAGCATTCCATCAGCTCTACCGCATTTAAGTGGCTATGTATAT
TTTAAGCTTGATAAGCAAGATTTTATCTTTACGCATTTTGCTAAGCAAAATGTTATCAGCCTTTATATGA
CAAATAATATCACAAAGCCCGACATTAAGCTTTGGGCATTATTTAACTAA