SecReT6
Protein ID: 32265750
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0251
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]242444..243232 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ7VJJ2
KEGG IDhhe:HH0251
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.10E-45, Aligned region: 25..237
Protein Sequence: 262 a.a.     [Download]
>gi|32265750|ref|NP_859782.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MNTEQELSLLLETNFANHCNNMQNNKILHLTLPLLLFATRLSKTGILDDSYITNTEETFANEILSIGSNL
NALRCYEDKDLIKLRYCLCVFIDEMLLHNESFINSHFAKHTLTIRLFDEMLGGDKFYGIANQWLLTPSKH
KDMLEFIYTCLILGYQGKYASDTQGKQKINHLCCNIANSLAPAMGSSEGKAFELALNHQEQTRILKLLHK
KYLRPFWLMAIICSIVALFFLFSFLKLESQKAITQDTLKQNLQHFKVSPHED
 
Nucleotide Sequence: 789 bp     [Download]
>gi|32265499|ref|NC_004917.1|:242444-243232 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGAACACAGAGCAAGAACTTTCCCTGCTACTTGAAACAAATTTTGCAAACCATTGCAACAATATGCAAA
ACAATAAGATTTTACACTTGACCTTGCCATTACTTTTGTTTGCTACACGACTTTCCAAAACAGGCATACT
TGATGATAGCTATATCACAAATACAGAAGAAACTTTTGCTAATGAAATCCTCTCTATCGGAAGCAATCTC
AATGCTTTGCGTTGTTATGAAGATAAGGATTTAATCAAACTCCGTTACTGCTTGTGTGTGTTTATTGATG
AAATGCTCTTACATAATGAAAGCTTTATCAATAGCCACTTTGCAAAACATACACTTACTATACGTCTTTT
TGATGAAATGCTAGGTGGAGATAAGTTTTATGGTATTGCCAATCAATGGCTTCTTACCCCAAGCAAACAC
AAAGATATGCTAGAATTTATCTATACATGCCTTATTTTGGGCTATCAAGGCAAATATGCCTCCGACACTC
AAGGCAAACAAAAAATTAATCATCTATGCTGCAATATAGCAAATTCTCTTGCTCCTGCTATGGGAAGTAG
CGAAGGAAAAGCTTTTGAATTAGCCCTCAATCATCAAGAGCAAACGCGTATTCTAAAACTTTTGCATAAA
AAATACTTGCGACCATTTTGGCTTATGGCTATCATTTGCTCCATCGTTGCATTATTCTTTCTTTTCTCAT
TTTTAAAGCTAGAATCTCAAAAAGCCATTACACAAGATACCCTTAAACAAAATTTGCAACACTTCAAGGT
ATCTCCACATGAGGATTAA