SecReT6
Protein ID: 32265752
SecReT6 ID47
T6SS typei1
Gene symbol-
Locus tagHH0253
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]246801..247781 [+]
Producthypothetical protein
NoteFha
UniProt IDQ7VJJ0
KEGG IDhhe:HH0253
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 3.30E-05, Aligned region: 28..94
Protein Sequence: 326 a.a.     [Download]
>gi|32265752|ref|NP_859784.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MEQIAILVEDIDNQAKPIYCVFDDNGGTIGNTSINHLCLPDESIQERHVNINYEDGCFTISCIGDSEVFY
NESFSKLEQGYETIIEVGDSFRIGKYKCSFIDTKDIKDDFLDYKKVLDKIADESDFAIDVKPRVQLDTKI
LDEENMADNLDKHKILEKLSPAQVINTIPSDIANTHDTIQNIITSSQSMITDSISKKEISPQTKESDIIL
HTKNIQTFLQGMLQSFSMPNNPLSHINMTTYEHILDTQELDSILHNTLLIDSIPLLNTLILALISKELHS
PYFEILEHDIFANSLTQAIIQSHQNSKESLQCMLLKALSTYLKNPL
 
Nucleotide Sequence: 981 bp     [Download]
>gi|32265499|ref|NC_004917.1|:246801-247781 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGGAGCAAATAGCAATTCTTGTAGAAGACATTGACAACCAAGCAAAACCGATTTATTGTGTTTTTGACG
ATAATGGAGGAACCATAGGCAATACTTCCATCAATCATTTGTGTTTGCCAGATGAATCTATTCAAGAAAG
ACATGTTAATATCAACTATGAAGATGGTTGCTTTACTATCTCTTGTATTGGGGATTCTGAAGTATTTTAC
AATGAATCTTTCTCTAAACTTGAGCAAGGCTATGAAACAATTATAGAAGTTGGGGATAGTTTTAGAATTG
GAAAATATAAATGTAGCTTTATAGACACAAAAGATATAAAAGATGACTTCCTAGACTATAAAAAAGTGCT
TGATAAAATTGCTGATGAAAGTGATTTTGCCATAGATGTTAAGCCTAGAGTGCAACTAGATACAAAAATA
TTAGATGAAGAAAATATGGCTGACAACTTAGATAAACATAAGATATTAGAAAAACTCTCTCCAGCACAAG
TTATAAATACCATACCCTCCGATATAGCAAACACTCACGATACTATACAAAACATTATCACTTCATCGCA
ATCAATGATAACAGATAGCATTTCTAAAAAAGAAATATCACCACAAACAAAGGAAAGTGATATTATCCTT
CATACCAAGAATATACAAACATTCCTACAAGGAATGCTACAATCTTTCTCTATGCCTAATAACCCCCTAT
CACACATCAATATGACAACTTATGAGCACATACTTGACACACAAGAGCTAGATTCTATCCTGCATAATAC
CTTGCTTATAGATTCTATCCCGCTTCTTAACACTCTCATACTAGCCCTTATTAGCAAAGAACTCCATAGC
CCATATTTTGAGATATTAGAACACGATATATTTGCAAACTCATTAACTCAAGCCATTATTCAATCTCATC
AAAATAGTAAAGAATCCTTACAATGTATGCTTTTAAAGGCACTTAGCACATACTTAAAGAATCCTCTTTA
G