SecReT6
Protein ID: 322835245
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4563
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]124539..125033 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDE8Y0X8
KEGG IDrah:Rahaq_4563
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-55, Aligned region: 6..158
Protein Sequence: 164 a.a.     [Download]
>gi|322835245|ref|YP_004215271.1| type VI secretion protein, VC_A0107 family [Rahnella sp. Y9602]
MSNSFQNEIPKARVNIKLDLHTGGAQKKVELPLKLMVMGDYSNGKENRPLSEREKVNINKNNFNSVLAEF
SPSLNLTVENTLTGDRSEENISLNFNEMKDFEPEQVARQIPQLRAMLAMRNLLRDLKSNLLDNVTFRKEL
EAILKDPALSNELRTELNALAPKA
 
Nucleotide Sequence: 495 bp     [Download]
>gi|322835126|ref|NC_015062.1|:124539-125033 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGTCTAATAGCTTCCAGAATGAAATTCCGAAAGCGCGCGTTAACATAAAACTTGATCTACACACTGGCG
GCGCACAGAAGAAAGTCGAATTACCGTTAAAATTGATGGTAATGGGTGATTACAGTAATGGAAAAGAGAA
CCGTCCGTTATCTGAACGCGAAAAAGTTAACATTAATAAGAATAACTTTAACAGCGTACTGGCTGAATTC
AGCCCTTCACTGAACCTGACCGTGGAAAATACGCTAACAGGTGATCGCAGCGAAGAAAATATCTCTCTAA
ATTTCAATGAAATGAAAGATTTTGAGCCAGAACAGGTTGCCCGTCAGATCCCCCAACTGCGCGCGATGCT
GGCAATGCGTAACTTATTACGTGACCTCAAATCCAATCTGCTCGACAACGTCACCTTCCGTAAAGAGCTC
GAAGCCATTCTAAAAGATCCTGCGCTGAGCAATGAACTGCGCACTGAACTTAATGCCCTGGCGCCAAAGG
CGTAA