SecReT6
Protein ID: 322835246
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4564
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]125071..126612 [+]
Producttype VI secretion protein, EvpB/VC_A0108 family
NoteTssC
UniProt IDE8Y0X9
KEGG IDrah:Rahaq_4564
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.70E-177, Aligned region: 88..509
Protein Sequence: 513 a.a.     [Download]
>gi|322835246|ref|YP_004215272.1| type VI secretion protein, EvpB/VC_A0108 family [Rahnella sp. Y9602]
MSVNTENSSSSQTTVLDRPDAGTVYASLFDKINLTPVSSLGDLNDFQDTSALADVTADQRVTAAVQVFLE
RLKLSGQTVERLDKTLLDHHIAELDSQISRQLDVVMHHPEFQRIESGWRGLKFLVDRTDFRQNVKIELLD
VSKDDLRQDFEDCPEIIQSGLYRHTYIQEYDTPGGEPIGSVISNYEFDASAQDVALLRNISKVSAAAHMP
FVGAVGPKFFLKDSMEEVAAIKDIGNYFDRAEYIKWKSFRDSDDSRYIGLTMPRVLGRLPYGPDTVPVRS
FNYVEEVKGPDHEKYLWTNAAFAFAANMVKSFIKNGWCVQIRGPQAGGAVTDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFANLGFIPLSYYKNRDYSCFFSANSAQKPALYDTANATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNTWIRTLVTEMTDPGDDLQASHPLRDAKVTVEDIEDNPGFFRVKLYAV
PHFQVEGMDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|322835126|ref|NC_015062.1|:125071-126612 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGTCAGTCAACACTGAAAACTCTTCTTCCAGCCAGACAACGGTTCTGGATCGCCCTGACGCCGGTACGG
TATACGCTTCCCTGTTTGATAAAATCAACCTGACGCCTGTGTCCTCACTGGGTGATCTGAACGATTTTCA
GGATACGTCTGCGCTGGCCGATGTCACCGCTGATCAGCGTGTCACTGCCGCTGTACAGGTCTTCCTTGAG
CGCCTGAAGCTGTCCGGTCAGACGGTTGAACGTCTGGACAAAACCCTGCTCGATCATCATATCGCCGAAC
TCGACAGCCAGATCAGCCGTCAGTTGGATGTGGTCATGCATCACCCGGAATTTCAGCGTATTGAATCCGG
CTGGCGTGGTCTGAAGTTCCTGGTTGATCGTACTGATTTCCGCCAGAACGTAAAAATTGAACTGCTGGAT
GTGTCTAAAGACGACCTCCGTCAGGACTTCGAAGATTGTCCTGAGATCATCCAGAGCGGCCTGTACCGCC
ATACCTACATTCAGGAATATGACACTCCGGGCGGCGAGCCAATCGGTTCTGTGATTTCCAACTACGAGTT
TGACGCGTCGGCGCAAGATGTCGCCCTGCTGCGTAACATTTCTAAAGTATCTGCCGCTGCGCATATGCCA
TTCGTCGGTGCGGTCGGCCCTAAATTCTTCCTGAAAGATTCCATGGAAGAAGTGGCGGCGATTAAAGATA
TCGGCAACTACTTTGACCGTGCGGAATACATCAAGTGGAAATCCTTCCGCGATTCTGACGATTCCCGCTA
TATCGGTCTGACCATGCCGCGCGTACTCGGTCGCCTGCCGTATGGTCCGGATACCGTTCCTGTTCGCAGC
TTCAACTACGTTGAAGAAGTGAAAGGTCCGGATCACGAGAAATATCTGTGGACAAACGCGGCGTTCGCCT
TTGCGGCCAACATGGTGAAAAGCTTCATCAAAAATGGCTGGTGTGTGCAAATCCGTGGCCCACAGGCGGG
CGGTGCAGTGACTGATCTGCCGATCCATCTGTACGATCTCGGCACCGGCAATCAGGTGAAAATCCCGTCA
GAAGTGATGATCCCGGAAACCCGCGAATTTGAATTTGCCAATCTGGGCTTTATCCCGCTGTCTTACTACA
AAAACCGCGATTACTCCTGCTTCTTCTCCGCGAACTCTGCGCAGAAACCGGCGCTGTACGATACTGCCAA
TGCCACTGCAAACAGCCGCATCAATGCACGCCTGCCGTACATCTTCCTGCTTTCACGCATCGCACACTAC
CTGAAGCTGATTCAGCGGGAAAATATCGGCACCACCAAAGACCGTCGTCTGCTGGAACTGGAACTGAACA
CCTGGATCCGTACGCTGGTCACTGAAATGACTGACCCGGGCGACGACCTGCAAGCCTCTCACCCGCTGCG
TGACGCCAAAGTGACCGTCGAAGATATCGAAGACAACCCGGGCTTCTTCCGCGTGAAACTGTACGCCGTA
CCGCACTTCCAGGTGGAAGGGATGGACGTGAATCTGTCACTGGTTTCTCAGATGCCTAAAGCGAAAGCGT
AA