SecReT6
Protein ID: 322835247
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4565
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]126628..127977 [+]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDE8Y0Y0
KEGG IDrah:Rahaq_4565
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.50E-127, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|322835247|ref|YP_004215273.1| type VI secretion protein, VC_A0114 family [Rahnella sp. Y9602]
MKIYRPLWSEGALLSPQQFQQQALWEAHSNQCVAHLSVVNPWGVATAEFDEGLLSVRRLQALQLTVRLPD
GSLIDTGSSDLLPPARDLSQDIPAQVNELTVMLAMPLLQANSSNVQLTDNAGDRPLRYRQEWVKVQDAFG
QEEESMAVARYALSLRFDIEQNEEYLICPVLRLVRDGQGGWRNDNTFIPPLLAMSAHHGLVLDMEQILTQ
LQAKRRRLMGMRRESNQRMADFAVADVSLFWLLNALNTHVSALSELVKNPARHPEQVWFELSKLAGSLLT
FSLEHDIEAIPAYDHASPETVFPPLLDLIGELLEASLPSRVISLEMHKINGQQWKAPLNDSRLREDADFY
LSVRSTLPAYQLISQFPALCKVGAPDDVNNIVNVALNGVPLIALSHVPAAIPLRLENQYFALDLKHPSAQ
AMLDSGTCMFYVPELLGELQLELYAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|322835126|ref|NC_015062.1|:126628-127977 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGAAAATTTATCGACCACTATGGAGTGAGGGGGCATTGCTGTCCCCTCAGCAGTTCCAGCAGCAGGCTT
TATGGGAAGCACATAGTAATCAATGTGTTGCCCACCTGTCCGTTGTTAATCCCTGGGGCGTAGCCACAGC
TGAGTTTGATGAAGGCTTGCTGAGTGTCAGACGCCTGCAAGCACTACAGCTGACCGTGCGTCTGCCTGAC
GGTTCTCTGATAGATACCGGGAGCAGCGATCTTCTCCCCCCTGCCCGGGATTTATCTCAGGATATTCCGG
CACAAGTCAATGAGCTTACGGTGATGCTGGCGATGCCGTTATTGCAGGCAAACAGCAGCAACGTGCAACT
CACTGACAACGCAGGGGATCGCCCGCTTCGTTATCGTCAGGAATGGGTGAAGGTTCAGGATGCATTCGGT
CAGGAAGAAGAGTCCATGGCGGTGGCCCGTTATGCCTTGTCTCTGCGTTTTGACATAGAACAGAACGAGG
AATACCTGATCTGTCCTGTATTACGTCTGGTTCGCGACGGTCAAGGCGGCTGGAGAAATGACAATACGTT
TATTCCTCCGTTGCTGGCAATGTCCGCTCATCACGGGCTGGTATTGGACATGGAACAAATTCTCACACAA
TTACAGGCTAAACGCCGCCGCCTGATGGGCATGCGCCGTGAGAGCAATCAGCGTATGGCCGATTTTGCCG
TCGCAGATGTATCACTGTTCTGGCTGCTTAATGCCCTCAATACGCACGTTTCGGCATTATCTGAACTGGT
TAAAAATCCGGCGCGACACCCTGAACAAGTCTGGTTTGAATTATCGAAACTGGCGGGGAGTCTGCTGACG
TTTTCCCTGGAACATGATATCGAAGCGATACCGGCTTACGACCATGCGTCCCCAGAGACCGTTTTCCCGC
CTTTACTTGACCTGATCGGGGAGCTACTGGAAGCCAGCCTTCCCTCGCGCGTTATCTCGCTGGAAATGCA
CAAGATCAATGGCCAGCAGTGGAAAGCGCCTCTTAATGACAGTCGCCTGCGTGAAGACGCGGACTTCTAC
CTGTCAGTGCGCTCAACACTGCCCGCTTATCAGCTGATTTCCCAGTTCCCTGCCTTGTGTAAAGTCGGGG
CTCCGGACGATGTCAATAATATTGTTAACGTCGCACTTAATGGCGTGCCACTGATCGCTTTAAGCCATGT
CCCTGCGGCAATCCCTCTTCGGCTGGAAAATCAATATTTCGCCCTGGATCTCAAACATCCCTCTGCGCAG
GCCATGCTGGATTCAGGTACGTGCATGTTCTATGTACCGGAACTTCTCGGTGAACTGCAACTGGAACTCT
ATGCGGTGCTTCGGTCATGA