SecReT6
Protein ID: 322835248
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4566
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]127974..128648 [+]
Producttype IV / VI secretion system protein, DotU family
NoteTssL
UniProt IDE8Y0Y1
KEGG IDrah:Rahaq_4566
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-46, Aligned region: 7..212
Protein Sequence: 224 a.a.     [Download]
>gi|322835248|ref|YP_004215274.1| type IV / VI secretion system protein, DotU family [Rahnella sp. Y9602]
MRNEIDIDELLADTWLSVVQLRNGVVAEEGEALYERCRAQVERVQDQLQLAGYDSESVEHITYAQCALLD
ETALGRQGEDTAPDNGHIAWQRAPLQARFFGSLQAGEALYERIRSVLRQPAPDITVLSCFHRVLLLGFQG
QYSAQTINPQQREQTLAALAGRVTPFNVVLPGALLSKTGRVRGGALFRSLWFWVLVAIVIVSGVWWGGHV
WLQHLINQQLPGQF
 
Nucleotide Sequence: 675 bp     [Download]
>gi|322835126|ref|NC_015062.1|:127974-128648 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGAGAAATGAAATAGATATTGATGAGTTACTGGCCGATACCTGGCTATCCGTTGTGCAGTTACGTAACG
GCGTGGTTGCAGAAGAAGGCGAAGCTTTATACGAGCGCTGCCGCGCTCAGGTAGAGCGAGTTCAGGACCA
ATTACAGCTGGCCGGTTACGATAGCGAAAGCGTTGAACATATCACTTATGCCCAATGTGCATTGCTGGAT
GAAACCGCACTCGGTCGACAGGGTGAGGACACGGCCCCTGATAACGGACATATTGCCTGGCAGCGGGCAC
CGTTACAGGCACGTTTCTTTGGCTCTCTTCAGGCAGGTGAAGCGTTATATGAACGGATCCGCTCTGTGCT
GCGTCAACCGGCTCCCGATATCACTGTGCTGAGCTGTTTTCATCGGGTCTTATTGCTGGGCTTTCAGGGG
CAATATAGCGCTCAAACCATCAACCCTCAGCAACGTGAGCAAACCCTCGCCGCACTTGCCGGGCGGGTCA
CGCCCTTCAACGTGGTGCTCCCGGGTGCATTGCTCAGTAAAACAGGACGGGTACGTGGCGGGGCATTATT
CCGCTCACTCTGGTTCTGGGTTCTGGTTGCTATTGTGATCGTGTCCGGTGTCTGGTGGGGCGGGCATGTC
TGGCTGCAACATCTGATTAATCAGCAATTGCCGGGGCAGTTCTGA