SecReT6
Protein ID: 322835249
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4567
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]128650..130326 [+]
ProductOmpA/MotB domain protein
NoteTagL
UniProt IDE8Y0Y2, E8Y0Y2
KEGG IDrah:Rahaq_4567
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 5.50E-15, Aligned region: 438..534
Protein Sequence: 558 a.a.     [Download]
>gi|322835249|ref|YP_004215275.1| OmpA/MotB domain protein [Rahnella sp. Y9602]
MRIGSRLSVYCLTGMTGCLALLLCWGFSPFAASTKSVITLITVILMAGLMLWGRRHDVFVDETTRLENLP
EISFSQPVVLVCGDKLDALFGETTVRITPLACYIKTDIAKPLSIFVDAVLSQRPGWIRQMAVLYSVSPEI
HADEAVCRAAIKSWRQQFYRLQKRIGCRIPVLVSCWLNGTASPWFVGAADGKMIVRDDDEGATLLSDWLS
SSDINMQPARQSQAICLEAACSWLRDVVLDEMQHPQTLSMPVLPVAVGVRFDAVSGVPDNLWSAALTRRT
TLNALMPLQSESVATLPFPDPLLPLLSGTTRHIRAGLAPVIAVILMMCFAVTAIGFVVNNNHRLITRIGM
DLKRYLIIPVNNYVPKAQAVAVLKLDAQLLERYHRQGEPLRLGLGLYQGERLWLTLQQEIDRYIPPPPPP
PPAEKHTAKTVRLDSLSLFDTGKYELKPGSLKMLVNTLVDIKAKPGWLIVVAGHTDITGDAKANQTLSLK
RAGSLRDWMLSTSDVSPTCFAVQGYGATRPVATNDTPEGRAANRRVEISLVPQADACKASATPSSSND
 
Nucleotide Sequence: 1677 bp     [Download]
>gi|322835126|ref|NC_015062.1|:128650-130326 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGCGCATCGGTTCTCGTTTATCAGTTTACTGCCTGACAGGGATGACAGGATGTCTGGCACTTCTGTTGT
GCTGGGGATTCAGCCCATTTGCCGCCTCCACAAAATCAGTCATTACCCTCATCACAGTGATCTTAATGGC
TGGACTGATGCTGTGGGGAAGGCGCCATGATGTGTTCGTCGATGAGACGACACGACTGGAAAACCTGCCG
GAGATATCGTTTTCGCAGCCGGTCGTTCTTGTTTGCGGGGACAAGCTGGATGCTCTGTTTGGTGAAACTA
CGGTACGGATTACCCCACTTGCCTGTTATATCAAGACAGACATCGCAAAACCGTTATCCATTTTCGTTGA
TGCGGTGCTATCACAACGTCCCGGCTGGATCCGCCAGATGGCCGTACTGTACAGCGTTTCGCCGGAAATT
CATGCCGATGAAGCTGTCTGCCGTGCCGCGATTAAAAGCTGGCGTCAGCAGTTTTATCGTTTGCAAAAGC
GCATCGGATGCCGCATTCCCGTGCTGGTCAGTTGCTGGCTGAACGGAACGGCGTCGCCCTGGTTTGTGGG
CGCTGCCGACGGAAAAATGATCGTCAGGGACGACGATGAAGGCGCAACACTGCTGAGTGACTGGTTGAGT
TCGTCAGACATCAATATGCAGCCCGCTCGCCAGTCTCAGGCTATCTGTCTTGAGGCAGCCTGTTCATGGC
TTCGGGACGTTGTGCTTGATGAAATGCAGCATCCTCAAACCCTGAGCATGCCGGTTCTTCCCGTGGCCGT
GGGTGTCAGGTTTGACGCCGTGTCGGGTGTGCCCGATAACCTTTGGTCTGCAGCATTGACGCGGCGTACC
ACACTGAATGCGCTGATGCCCTTGCAATCAGAGAGCGTGGCAACTCTGCCTTTTCCCGATCCCTTGTTAC
CGCTGCTGTCCGGCACTACCCGACATATCAGGGCCGGACTGGCACCGGTAATCGCCGTCATTCTCATGAT
GTGTTTTGCGGTAACGGCCATTGGTTTTGTTGTTAACAACAACCACCGGCTCATTACGCGTATCGGTATG
GATCTGAAGCGCTATCTGATCATTCCTGTGAACAATTACGTTCCGAAAGCACAAGCCGTTGCCGTGCTGA
AACTGGATGCTCAGTTGCTTGAGCGTTATCACCGCCAGGGCGAGCCTTTACGTCTGGGTTTGGGACTTTA
TCAGGGTGAACGACTCTGGCTGACTCTGCAGCAGGAAATTGATCGTTACATTCCTCCCCCTCCACCGCCG
CCACCGGCTGAGAAACACACAGCTAAAACCGTGCGTCTTGATTCCCTGTCGCTGTTTGATACGGGTAAGT
ACGAGCTTAAACCGGGCTCACTCAAAATGCTGGTGAATACGCTGGTCGATATCAAGGCCAAACCAGGCTG
GCTGATTGTGGTGGCCGGACACACGGACATTACCGGTGACGCGAAAGCCAACCAGACATTGTCGCTAAAA
CGTGCGGGATCCTTGCGTGACTGGATGCTCTCAACCAGCGATGTCTCGCCGACCTGCTTTGCCGTACAGG
GCTACGGCGCAACACGCCCTGTTGCAACAAACGATACCCCGGAAGGCCGTGCGGCTAACCGTCGTGTCGA
AATCAGTCTGGTGCCACAGGCAGATGCCTGCAAAGCATCAGCAACCCCAAGTTCATCAAATGATTGA