SecReT6
Protein ID: 322835251
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4569
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]130947..133667 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE8Y0Y4
KEGG IDrah:Rahaq_4569
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.10E-41, Aligned region: 261..281
AAA_2 [PF07724], Evalue: 7.10E-41, Aligned region: 635..799
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 263..375
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 640..760
AAA_5 [PF07728], Evalue: 5.80E-15, Aligned region: 263..287
AAA_5 [PF07728], Evalue: 5.80E-15, Aligned region: 639..759
ClpB_D2-small [PF10431], Evalue: 2.80E-14, Aligned region: 408..432
ClpB_D2-small [PF10431], Evalue: 2.80E-14, Aligned region: 806..878
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 121..223
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 240..284
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 308..341
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 514..531
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 609..683
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 703..733
AAA_16 [PF13191], Evalue: 1.10E-11, Aligned region: 778..831
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 262..348
AAA_22 [PF13401], Evalue: 1.40E-08, Aligned region: 638..660
AAA_17 [PF13207], Evalue: 3.90E-07, Aligned region: 263..395
AAA_17 [PF13207], Evalue: 3.90E-07, Aligned region: 539..559
AAA_17 [PF13207], Evalue: 3.90E-07, Aligned region: 638..675
AAA_17 [PF13207], Evalue: 3.90E-07, Aligned region: 822..844
AAA_25 [PF13481], Evalue: 5.00E-07, Aligned region: 263..287
AAA_25 [PF13481], Evalue: 5.00E-07, Aligned region: 316..351
AAA_25 [PF13481], Evalue: 5.00E-07, Aligned region: 513..563
AAA_25 [PF13481], Evalue: 5.00E-07, Aligned region: 637..668
Arch_ATPase [PF01637], Evalue: 1.30E-06, Aligned region: 241..279
Arch_ATPase [PF01637], Evalue: 1.30E-06, Aligned region: 315..413
Arch_ATPase [PF01637], Evalue: 1.30E-06, Aligned region: 633..656
NACHT [PF05729], Evalue: 3.90E-06, Aligned region: 263..360
NACHT [PF05729], Evalue: 3.90E-06, Aligned region: 639..662
IstB_IS21 [PF01695], Evalue: 1.00E-05, Aligned region: 257..323
IstB_IS21 [PF01695], Evalue: 1.00E-05, Aligned region: 639..657
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 263..364
AAA_14 [PF13173], Evalue: 1.20E-05, Aligned region: 638..729
AAA_19 [PF13245], Evalue: 2.50E-05, Aligned region: 260..283
AAA_19 [PF13245], Evalue: 2.50E-05, Aligned region: 637..661
AAA_23 [PF13476], Evalue: 5.00E-05, Aligned region: 263..281
AAA_23 [PF13476], Evalue: 5.00E-05, Aligned region: 473..559
AAA_23 [PF13476], Evalue: 5.00E-05, Aligned region: 637..663
Zeta_toxin [PF06414], Evalue: 8.10E-05, Aligned region: 257..287
Zeta_toxin [PF06414], Evalue: 8.10E-05, Aligned region: 638..679
Sigma54_activat [PF00158], Evalue: 8.70E-05, Aligned region: 246..277
Sigma54_activat [PF00158], Evalue: 8.70E-05, Aligned region: 638..756
DUF258 [PF03193], Evalue: 0.0009, Aligned region: 184..236
DUF258 [PF03193], Evalue: 0.0009, Aligned region: 246..280
DUF258 [PF03193], Evalue: 0.0009, Aligned region: 639..651
Clp_N [PF02861], Evalue: 0.0023, Aligned region: 45..88
SRP54 [PF00448], Evalue: 0.0023, Aligned region: 263..285
SRP54 [PF00448], Evalue: 0.0023, Aligned region: 638..684
AAA_18 [PF13238], Evalue: 0.0026, Aligned region: 263..289
AAA_18 [PF13238], Evalue: 0.0026, Aligned region: 640..664
AAA_33 [PF13671], Evalue: 0.0036, Aligned region: 263..280
AAA_33 [PF13671], Evalue: 0.0036, Aligned region: 638..657
AAA_33 [PF13671], Evalue: 0.0036, Aligned region: 769..839
RNA_helicase [PF00910], Evalue: 0.0048, Aligned region: 264..285
RNA_helicase [PF00910], Evalue: 0.0048, Aligned region: 640..661
AAA_29 [PF13555], Evalue: 0.008, Aligned region: 257..279
AAA_29 [PF13555], Evalue: 0.008, Aligned region: 637..650
Protein Sequence: 906 a.a.     [Download]
>gi|322835251|ref|YP_004215277.1| type VI secretion ATPase, ClpV1 family [Rahnella sp. Y9602]
MGLGFLQRKRLRAVAYLKKEFSMEHQSAVLLRRLNPYCAKALEAAATLCQTRAHNEITVEHWLLKLLELG
EGDITVLARRYEWDMDALWQSLLAHLDALPRSVHSRPQLSQDLQSLMKAGWLAASLQDDNQSIRSVNLLE
ALMAQPRLLRCEGLWPLFSLSEEHIRRLKPVLDALSEERPELQRQESLSRTPSALSENSATQNAESGVTG
QSLSEALQAALDKFTLDVTAKAKAGQIDPVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLA
LRISEGNVPDSLKTVSLRTLDLGLLQAGAGVKGEFEQRLKNVIDAVQKSPTPVLLFIDEAHTIIGAGNQA
GGADAANLLKPALARGELRTIAATTWSEYKQYFERDAALERRFQIVKVDEPDDEMACLMLRGLKSRYAQH
HGVHITDEAVKAAVSLSRRYITGRQLPDKAVDLLDTASARVRMSLDTLPEELTRLKAQIAALGMEEQALL
EDIALGSQSHGERLEKIGELERELNAQLSALEAQYEAEKALTHKLLEIRQDISRQEDIHALQQELAQLQG
SAPLLSLDVDVRTVATVIADWTGVPLTSLLKDEQTDLLQLENHLGKRVVGQDHALTDMAQRLRAAKTGLT
SENGPLGVFLLVGPSGVGKTETALSLADCLFGGEKSLITINLSEYQEAHTVSQLKGSPPGYVGYGQGGIL
TEAVRKRPYSVVLLDEVEKAHRDVINLFYQVFDRGFMRDGEGREIDFRNTVILMTANLGSDHIMQLLDEQ
PEATDSDLQELLRPILRDHFQPALLARFQTLIYRPLNAVALRTIVEMKLAQVAKRLNKHYGLTCSIEESL
YDTLVAACLLPDTGARNIDSLLNQQILPVLSQQLLQRMAGQQPTTALALGWDEDEGITLEFDGEQK
 
Nucleotide Sequence: 2721 bp     [Download]
>gi|322835126|ref|NC_015062.1|:130947-133667 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGGCCTGGGTTTCCTGCAAAGGAAAAGGCTAAGGGCGGTAGCGTACCTAAAAAAGGAATTTAGCATGG
AACATCAGTCAGCTGTCTTACTTCGCCGCTTAAATCCGTACTGCGCGAAAGCGCTGGAAGCCGCCGCGAC
GCTCTGCCAGACCCGCGCCCACAATGAAATTACCGTCGAGCACTGGTTGCTCAAACTGCTGGAACTGGGC
GAAGGCGACATCACCGTGCTGGCCCGCCGCTATGAATGGGATATGGATGCGCTGTGGCAAAGCCTGCTGG
CACATCTCGATGCCCTGCCGCGTTCCGTGCATTCGCGTCCGCAGCTTTCCCAAGATTTACAATCGCTGAT
GAAAGCGGGCTGGCTGGCCGCATCGCTGCAGGATGACAACCAGAGCATCCGCAGTGTCAATCTGCTGGAA
GCGCTGATGGCGCAACCACGCCTGTTGCGCTGCGAAGGTTTATGGCCGCTGTTCAGCCTGAGCGAAGAAC
ATATCCGTCGCCTCAAGCCCGTGCTGGATGCCTTGTCCGAAGAGCGCCCGGAGCTGCAACGACAGGAAAG
CCTTAGCCGCACGCCTTCCGCACTTTCTGAAAACTCAGCGACACAAAATGCAGAGTCTGGTGTTACCGGC
CAGTCGTTAAGCGAAGCATTGCAGGCCGCGCTCGATAAATTCACGCTGGATGTCACCGCGAAAGCTAAAG
CCGGACAGATTGATCCGGTGTTTGGTCGCGATAACGAGATCCGTCAGATGGTGGACATTCTGTCCCGTCG
TCGCAAAAACAACCCGATTTTAGTCGGTGAACCGGGCGTCGGTAAGACCGCGCTGGTGGAAGGTCTTGCA
CTGCGCATCAGTGAAGGCAACGTGCCGGACAGCCTGAAAACCGTCAGCCTGCGCACGCTGGATTTAGGTC
TGCTACAGGCCGGTGCCGGAGTAAAAGGCGAGTTCGAGCAACGCCTGAAAAACGTCATCGACGCCGTGCA
AAAATCACCCACACCGGTTCTGCTGTTTATCGATGAAGCGCACACTATTATTGGCGCTGGCAATCAGGCC
GGTGGCGCCGACGCTGCTAACCTGCTCAAACCCGCTCTCGCCCGTGGTGAATTGCGCACCATCGCCGCCA
CGACCTGGTCTGAGTACAAACAGTATTTTGAGCGCGATGCCGCCCTTGAGCGCCGCTTCCAGATTGTCAA
AGTCGATGAGCCGGACGACGAGATGGCCTGCCTGATGCTGCGCGGCCTGAAATCCCGCTACGCGCAGCAC
CACGGCGTTCACATCACCGACGAAGCCGTCAAAGCCGCCGTCAGCCTTTCCCGCCGCTACATCACCGGCC
GCCAGCTGCCGGACAAAGCCGTTGACCTGCTCGATACCGCGTCCGCCCGTGTACGCATGAGCCTCGATAC
CCTGCCGGAAGAGCTGACCCGCCTTAAGGCGCAGATAGCCGCACTGGGAATGGAGGAGCAGGCATTGCTG
GAAGATATCGCGCTCGGCAGCCAGAGCCACGGCGAACGTCTGGAGAAAATTGGCGAACTTGAGCGCGAAC
TCAATGCCCAGCTTTCCGCTCTCGAAGCGCAGTACGAAGCCGAAAAAGCCCTGACGCATAAGCTGCTGGA
AATCCGTCAGGACATCAGCCGTCAGGAAGATATTCACGCGCTGCAACAAGAACTGGCTCAGTTGCAGGGC
AGCGCCCCGCTGCTGTCTCTTGACGTGGACGTCCGCACCGTTGCGACAGTCATTGCCGACTGGACCGGCG
TGCCGCTGACCAGCCTGCTGAAGGACGAACAGACTGACCTGTTGCAACTGGAAAACCATCTGGGCAAACG
TGTCGTCGGACAGGATCATGCGCTGACCGACATGGCGCAACGCCTGCGTGCCGCCAAAACCGGCCTGACG
TCTGAGAATGGCCCGCTGGGCGTCTTCCTGCTGGTCGGTCCGAGCGGTGTCGGTAAAACGGAAACCGCAC
TTTCCCTCGCGGACTGCCTGTTCGGCGGCGAGAAATCCCTTATCACCATTAACCTCAGCGAATACCAGGA
AGCGCACACCGTATCCCAGCTGAAAGGCTCACCTCCGGGATACGTCGGTTACGGTCAGGGCGGTATTCTG
ACGGAAGCCGTGCGTAAACGACCGTACAGCGTCGTCCTGCTTGATGAAGTGGAAAAAGCCCACCGGGATG
TCATTAACCTGTTCTATCAGGTATTCGACCGCGGCTTTATGCGAGATGGTGAAGGCCGCGAAATCGACTT
CCGTAACACCGTCATTCTGATGACTGCGAATCTGGGCAGCGACCACATCATGCAGTTGCTGGATGAACAG
CCGGAAGCCACCGACAGCGATTTGCAGGAACTGCTGCGCCCGATCCTGCGCGATCATTTCCAGCCCGCCC
TGCTCGCCCGTTTCCAGACGCTGATTTATCGTCCGCTGAATGCCGTTGCCCTGCGCACTATCGTTGAGAT
GAAACTGGCACAAGTCGCGAAACGTCTGAACAAGCACTATGGCCTGACCTGCTCCATAGAAGAAAGTCTG
TACGACACGCTGGTCGCCGCCTGCCTGCTGCCGGACACCGGCGCCCGCAACATCGACAGCCTGCTCAATC
AGCAGATACTGCCGGTGCTGAGCCAGCAACTGCTGCAGCGCATGGCCGGGCAACAGCCCACTACTGCGCT
GGCGCTGGGCTGGGATGAAGACGAAGGGATCACGCTGGAATTTGACGGAGAACAGAAATGA