SecReT6
Protein ID: 322835252
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4570
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]133664..136006 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDE8Y0Y5
KEGG IDrah:Rahaq_4570
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-66, Aligned region: 35..349
DUF2345 [PF10106], Evalue: 4.00E-39, Aligned region: 265..291
DUF2345 [PF10106], Evalue: 4.00E-39, Aligned region: 569..569
DUF2345 [PF10106], Evalue: 4.00E-39, Aligned region: 605..745
T6SS_Vgr [PF13296], Evalue: 2.50E-34, Aligned region: 481..586
T6SS_Vgr [PF13296], Evalue: 2.50E-34, Aligned region: 622..644
Phage_base_V [PF04717], Evalue: 1.20E-14, Aligned region: 395..476
Protein Sequence: 780 a.a.     [Download]
>gi|322835252|ref|YP_004215278.1| Rhs element Vgr protein [Rahnella sp. Y9602]
MSTSDVINRLLNQSRYRLDVLQSPAFLDVLRFEGEEQLSKPFEYIIHVTSTATDLTAEQLVLKPATFTMQ
APVFDIAGVAEPVRAVHGVIQHFSRISTSADQTIYRLVLVPRVALLDHTAKCALYLNQSVQEVVEKVLRA
HGLEGPDFEFQLSRQYPARELITQWRETDLAFIQRLLAEVGIYWHLEMDTRLEHDVIIFADSQQQYKFGV
RLPLRNQAGMSDSGTESVWGLSTQHQVVTQQVSTRDYNYREALSPMDTTASAAGGDETTTGEVYQYAEPF
LQSGSEDGVETGAFYARLRHERIMNAQKTVTGHSSCPHLAPGQVLEVDGTLPSVLNEGILLTGIKTYGSR
KSRFTAQLTGQPYSETLCFRPVLPERPVIAGTLPARVESTTKGDIYSWLDNQGRYRVKLDFDRDEQEQGY
ACLWLRMAKPYAGDTYGWHAPLLDGTEVAIAFDSGDCDRPYIAYALHDSAHSDHVTDDNHTRNVLRTPSF
NKLRMEDKRSEEHIKLATEFGKTQLNMGHLVDAERAQRGAGFEIRTDEHGVMRAGKGIFVSAEEQLKAQG
KVLDMDPALGQIHQANNEMQALSDAAMQATALASDIQKQLSFVDNRLTQLQSAAILASAPMGVALTSGEH
LQLAARQNLMVNAGNNADVGVMKNLFIGAGEALSMFVHKQDATLIANQGQVTIQAQNNAMSLTARQTLTI
TSSDDEIIITTPKKLTLNGGGSYLTLEASKIEHGSSGDMTIKCTNYLVPMVGASKPSDTPKFPIVTMENL
TEENGKDFSG
 
Nucleotide Sequence: 2343 bp     [Download]
>gi|322835126|ref|NC_015062.1|:133664-136006 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGAGCACCTCCGATGTTATCAACAGATTGCTAAACCAGTCCCGCTATCGTCTGGACGTTTTGCAAAGTC
CTGCATTTCTCGACGTGTTGCGCTTCGAAGGGGAAGAGCAACTTAGCAAACCCTTTGAATATATTATTCA
TGTCACCAGCACGGCCACCGATTTAACCGCTGAACAACTGGTTCTCAAACCGGCTACCTTTACCATGCAG
GCTCCCGTGTTTGATATTGCAGGCGTTGCGGAGCCGGTCCGGGCTGTACACGGTGTGATTCAACATTTTT
CACGTATCTCTACCTCTGCGGATCAGACGATTTACCGGCTGGTTTTGGTTCCGCGCGTAGCCTTACTGGA
CCACACTGCAAAGTGCGCACTTTATCTAAATCAGTCAGTGCAGGAAGTGGTTGAAAAGGTTCTTCGGGCA
CACGGCCTGGAAGGCCCGGACTTCGAATTCCAGCTTTCCAGGCAATACCCGGCACGTGAGCTTATCACCC
AGTGGCGGGAAACAGATTTAGCTTTCATCCAGCGTTTACTGGCTGAAGTCGGAATTTACTGGCATCTCGA
GATGGACACCCGCCTTGAGCATGACGTCATCATATTTGCCGACAGCCAGCAACAATATAAATTTGGAGTC
CGTTTACCCTTACGCAACCAGGCTGGCATGAGCGACAGCGGTACCGAAAGCGTCTGGGGGCTGAGCACGC
AGCATCAGGTCGTCACGCAACAGGTTTCCACCCGCGATTACAACTACCGGGAAGCATTAAGTCCGATGGA
CACCACTGCCAGTGCGGCAGGAGGTGATGAAACTACCACTGGCGAAGTCTATCAGTACGCGGAGCCTTTT
CTGCAATCCGGATCCGAAGACGGGGTTGAAACCGGTGCATTTTATGCCCGCCTGCGTCATGAACGCATAA
TGAATGCTCAGAAGACCGTCACCGGCCACAGCAGTTGCCCTCATCTGGCACCGGGTCAGGTGCTGGAAGT
CGATGGCACACTTCCTTCTGTGTTAAATGAAGGCATCCTGCTGACGGGGATAAAAACCTACGGTTCACGC
AAAAGTCGTTTTACCGCACAATTGACCGGTCAGCCTTACAGTGAAACCCTCTGCTTCCGCCCTGTTCTGC
CAGAGCGCCCGGTAATCGCCGGTACCCTTCCTGCCCGGGTTGAAAGCACCACCAAAGGCGATATCTATTC
CTGGCTGGATAATCAGGGCAGATACCGCGTGAAGCTCGATTTTGACCGCGACGAACAGGAACAGGGCTAT
GCCTGTCTCTGGTTGCGTATGGCAAAACCTTACGCCGGTGATACCTACGGCTGGCACGCGCCTTTACTCG
ATGGCACTGAAGTCGCCATCGCTTTCGATTCCGGCGACTGTGACCGGCCTTATATCGCGTATGCCCTGCA
TGATTCAGCACACAGTGACCATGTCACCGACGACAACCATACGCGCAATGTCCTGCGTACTCCGTCTTTC
AACAAGCTGCGGATGGAAGACAAACGCTCAGAGGAACACATCAAGCTTGCGACCGAGTTTGGCAAAACGC
AGCTGAACATGGGGCATCTGGTGGATGCGGAACGCGCACAGCGCGGTGCCGGTTTTGAAATCAGGACGGA
TGAACACGGCGTGATGCGCGCGGGCAAAGGGATATTTGTCAGTGCAGAAGAACAACTCAAGGCGCAGGGA
AAAGTGCTGGATATGGATCCGGCCCTCGGTCAAATCCATCAGGCCAACAATGAGATGCAGGCTCTGAGTG
ATGCCGCCATGCAGGCTACCGCGCTGGCATCAGATATTCAAAAGCAGCTCAGCTTTGTCGATAACCGCCT
GACGCAGTTGCAGTCCGCGGCCATTTTAGCCAGCGCCCCGATGGGCGTGGCGCTTACCAGCGGTGAGCAT
TTACAGCTGGCAGCCCGACAGAATCTGATGGTGAACGCCGGTAACAATGCCGACGTTGGCGTCATGAAAA
ACCTGTTCATCGGCGCAGGTGAAGCGTTAAGCATGTTTGTACATAAGCAGGATGCCACGCTGATTGCCAA
TCAGGGACAGGTCACTATCCAGGCGCAAAACAACGCCATGTCCCTGACCGCAAGACAAACCCTGACCATC
ACCAGCTCGGACGATGAAATCATCATTACCACTCCGAAAAAACTGACCCTCAACGGCGGCGGCTCTTATC
TGACGCTGGAGGCAAGTAAAATCGAGCACGGGTCTTCCGGCGATATGACGATTAAGTGCACGAACTACCT
GGTGCCGATGGTGGGGGCTTCAAAACCAAGCGATACACCTAAATTTCCTATTGTCACGATGGAAAACTTG
ACTGAAGAGAATGGGAAGGATTTTTCTGGATAA