SecReT6
Protein ID: 322835258
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4576
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]141799..142062 [+]
Producthypothetical protein
NotePAAR
UniProt IDE8Y0Z1
KEGG IDrah:Rahaq_4576
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.80E-29, Aligned region: 5..80
Protein Sequence: 87 a.a.     [Download]
>gi|322835258|ref|YP_004215284.1| hypothetical protein Rahaq_4576 [Rahnella sp. Y9602]
MLPIIRIGDKTTHGGAVVTGSGTMSFGNIPVARKGDKVSCPVPFHGPTFITEGNPNYLDNGIPVAFHGHK
CACGCTLISSLATAQVG
 
Nucleotide Sequence: 264 bp     [Download]
>gi|322835126|ref|NC_015062.1|:141799-142062 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGCTTCCTATTATTCGTATCGGCGATAAAACAACGCACGGCGGTGCAGTAGTGACCGGTTCCGGTACCA
TGAGTTTTGGTAATATTCCCGTTGCCCGTAAAGGGGATAAAGTCTCTTGCCCTGTTCCCTTTCACGGTCC
GACCTTCATTACCGAAGGCAATCCCAATTACCTGGACAACGGTATTCCTGTCGCTTTTCACGGACATAAA
TGTGCCTGCGGTTGCACGCTGATTAGTTCTCTTGCAACGGCACAAGTAGGATAA