SecReT6
Protein ID: 322835261
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4579
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]146789..148558 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDE8Y0Z4
KEGG IDrah:Rahaq_4579
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.50E-183, Aligned region: 6..586
Protein Sequence: 589 a.a.     [Download]
>gi|322835261|ref|YP_004215287.1| type VI secretion protein, VC_A0110 family [Rahnella sp. Y9602]
MDDLTLRYYEAEMRYLREAGREFAHAHPDRAAMLNLDKSGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLAIVELKPDYRQLKQVEIVPRGFSVLSQPVGQKHTCCQYQVTRDMPLMPIN
ISQAKLHTETDGRSTVRLRFDCGPLADWRKIDLSRVAIYLDADSPVSSALHLALTRKVQTMYVRQPELGQ
DRRAIDGWFKPMGFEENERLWPKGSSAFSGYQLLLEYFTFRPKFMFVELNGLQNVHLVPGTTWFELDIVL
SELWPYDLPFDTDTFRLHCVPVINLFSLEADPLQIDPLANEYLLRPLRMQDGHVEIYSVDQVHGSVKNGK
HDYVPFTSFRHRGGMMRHDAPERYFHTRVKRGPSGLHDTWLILGGKSFEAEQLAEQREALSLRITGTNGQ
LPRKALESTLLNRVVKAGKVPVQVRNLTTPTMPVYPPANDRFHWRVMSHLGSSFLSMMDNPEVLRGTLAL
YDWTDDEMNCRRLEAIVAVEHHLIQRFEKGFMLRGVDIEITLNTDNFAGEGDVNLFGEMLHRFFALYADI
HLFNQLTLVLQPTGKRLRWNENHSQHVPG
 
Nucleotide Sequence: 1770 bp     [Download]
>gi|322835126|ref|NC_015062.1|:146789-148558 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGATGATTTGACCCTGCGCTATTACGAAGCTGAGATGCGTTACCTGCGCGAGGCCGGGCGCGAATTTG
CCCATGCCCATCCCGACCGGGCCGCGATGCTCAACCTGGATAAGTCCGGGGCGCGCGATCCGTACGTTGA
ACGTTTATTTGAAGGTTTCGCATTTCTGATGGGGCGTCTGCGGGAGAAACTGGACGATGACCTGCCGGAA
CTCACAGAGGGACTGGTCAGCCTCTTGTGGCCACACTATATGCGGACAATCCCTTCACTGGCCATTGTTG
AATTGAAACCTGATTACCGGCAACTCAAGCAGGTGGAGATCGTGCCCCGGGGCTTCTCTGTCCTGTCACA
GCCTGTCGGGCAAAAACACACCTGCTGCCAGTATCAGGTGACGCGGGATATGCCGCTTATGCCGATCAAT
ATTTCACAGGCGAAGTTGCATACTGAAACAGACGGGCGTTCAACCGTACGCCTGCGTTTTGACTGCGGTC
CGCTGGCGGACTGGCGAAAGATAGATTTAAGCCGCGTGGCAATCTATCTCGATGCCGACAGTCCGGTCAG
CAGTGCTTTGCATCTGGCCCTGACCCGCAAAGTGCAGACCATGTATGTCCGCCAGCCGGAGTTGGGTCAG
GATCGCCGTGCGATAGACGGCTGGTTCAAGCCCATGGGATTTGAAGAAAATGAACGCCTGTGGCCTAAAG
GGAGCTCGGCGTTCAGTGGCTATCAGTTGTTACTGGAATACTTTACCTTCCGCCCAAAATTTATGTTCGT
TGAGCTGAATGGACTGCAAAATGTCCATCTGGTACCGGGGACGACATGGTTCGAACTCGATATTGTTTTG
AGTGAGTTGTGGCCTTATGACCTGCCGTTTGATACCGATACCTTCCGGTTACACTGCGTTCCGGTCATTA
ACCTGTTTTCACTGGAAGCCGACCCGCTGCAAATTGATCCACTGGCGAATGAATATCTTTTGCGGCCACT
GCGAATGCAGGATGGTCACGTAGAAATCTACAGTGTTGATCAGGTACACGGTTCCGTTAAAAACGGCAAA
CACGACTACGTGCCCTTCACCAGTTTCCGTCACCGCGGGGGCATGATGCGTCATGATGCTCCCGAACGCT
ATTTCCACACACGTGTTAAGCGCGGGCCTTCTGGCTTGCATGACACATGGTTAATTCTCGGCGGTAAATC
CTTTGAAGCAGAACAGCTTGCTGAACAGCGTGAAGCACTTTCACTGCGTATTACCGGGACCAACGGCCAG
CTTCCACGTAAGGCGCTGGAAAGTACCCTGCTCAACCGGGTTGTGAAAGCCGGCAAAGTCCCGGTACAAG
TTCGCAACCTCACCACGCCTACCATGCCGGTATATCCGCCTGCCAATGATCGCTTCCACTGGCGGGTGAT
GAGTCACCTGGGTTCAAGCTTCCTCAGCATGATGGATAACCCAGAGGTGCTGCGAGGCACGCTGGCGCTG
TATGACTGGACCGATGATGAAATGAACTGCCGCAGGCTCGAGGCGATTGTTGCCGTCGAACACCACCTGA
TCCAGCGATTTGAAAAAGGGTTCATGCTGCGCGGTGTCGATATAGAAATCACCCTGAATACAGACAACTT
CGCGGGTGAAGGGGACGTCAATCTCTTTGGTGAAATGCTGCACCGCTTCTTTGCCTTGTACGCCGATATT
CACCTTTTCAATCAGCTGACGCTGGTGTTGCAACCGACAGGAAAACGCCTGAGATGGAACGAGAATCACA
GCCAACACGTACCGGGCTGA