SecReT6
Protein ID: 322835262
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4580
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]148522..149604 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDE8Y0Z5
KEGG IDrah:Rahaq_4580
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.30E-79, Aligned region: 20..321
Protein Sequence: 360 a.a.     [Download]
>gi|322835262|ref|YP_004215288.1| type VI secretion protein, VC_A0111 family [Rahnella sp. Y9602]
MERESQPTRTGLIDALSPQAPYLNFYRFCQLLEQAGGEAPLLGTTSTPATDPIRFRPHPGMGFPVSEIRA
IEADREHIHATPTVRTTFMGLYGVDAPLPTGYLDDISQRREGYESVEHFLDIFNHRLMTQFYRIWRKYAY
PASFQAGGTDETSQCLLGLIGLGIPGTAKHIATPISRFLALLSTMRLPTRTAEGIRALVNLLAPRTQAYI
QGHDPVSVEMRTRSGFCAENRVALAQRSVLGRKGKDGNSRVLVSLMTSDPEEAEGWLPGGHLHTDLLVMM
RVYLGYRCNARLQLTVPTRLLPEPRLGGSRRIQLGRTGVLGLQESKRDSLPQSMTVSLGTYQGVHEEPLL
PAESGEYRFR
 
Nucleotide Sequence: 1083 bp     [Download]
>gi|322835126|ref|NC_015062.1|:148522-149604 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGAACGAGAATCACAGCCAACACGTACCGGGCTGATCGATGCCCTGAGTCCGCAGGCGCCCTATCTGA
ATTTTTACCGGTTTTGTCAGCTTCTGGAACAGGCTGGCGGGGAAGCTCCGCTGCTCGGTACAACCAGCAC
TCCCGCAACAGATCCAATACGTTTTCGCCCGCATCCTGGCATGGGTTTTCCGGTCAGCGAAATACGCGCC
ATAGAAGCCGACCGGGAACATATACACGCCACACCCACTGTTCGCACCACCTTTATGGGGCTCTATGGGG
TAGATGCCCCCTTACCCACAGGCTATCTCGACGATATCAGCCAACGGCGGGAAGGATACGAAAGCGTTGA
GCATTTTCTGGATATTTTCAACCATCGGCTGATGACGCAGTTCTATCGCATCTGGCGTAAATACGCCTAC
CCCGCTAGTTTCCAGGCTGGCGGAACGGATGAGACATCACAGTGCCTGCTCGGTCTGATTGGTCTGGGGA
TACCCGGCACGGCCAAACATATCGCGACGCCGATTTCCCGATTTCTGGCGCTTTTAAGCACTATGCGTTT
GCCGACACGAACGGCAGAAGGGATCCGTGCACTGGTGAATCTGCTGGCACCGCGAACGCAGGCTTATATT
CAGGGGCATGACCCGGTGTCAGTAGAAATGCGTACTCGCAGCGGGTTTTGCGCTGAAAACCGTGTTGCGC
TGGCACAGCGCAGCGTACTGGGCCGCAAAGGAAAAGACGGTAATAGCCGGGTACTGGTGAGTCTGATGAC
CTCCGATCCTGAAGAAGCTGAAGGATGGTTACCCGGCGGCCATTTGCATACCGATTTACTTGTGATGATG
CGGGTATATCTCGGCTACCGGTGCAATGCCCGCCTGCAACTCACCGTCCCTACCCGCTTGCTGCCGGAGC
CCCGGCTCGGTGGGTCCCGACGGATACAGCTCGGGCGTACCGGTGTGCTGGGTTTACAGGAAAGCAAACG
TGACAGCCTGCCGCAAAGTATGACCGTCAGCCTCGGCACCTATCAGGGTGTACATGAAGAACCCTTGCTA
CCCGCTGAGTCGGGAGAATACCGGTTCCGTTAA