SecReT6
Protein ID: 322835263
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4581
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]149668..150210 [+]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDE8Y0Z6
KEGG IDrah:Rahaq_4581
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.70E-37, Aligned region: 20..171
Protein Sequence: 180 a.a.     [Download]
>gi|322835263|ref|YP_004215289.1| type VI secretion lipoprotein, VC_A0113 family [Rahnella sp. Y9602]
MAKIISSPTRWQYFSLFLLAVLLSGCGLTQKVVDGTKGVTKAIFYKQIKTLHLDFSPRTSMNTDEGDQSS
LATMVRVYQLKDRKAFDAADYEKLLLQADNLLKADALASKEVLVMPGGDVSLDMPMEPDAQFVAVVALFR
NPDRQHDTWRVVLKREELDPDKPRTLELSNGQLTLLPLKD
 
Nucleotide Sequence: 543 bp     [Download]
>gi|322835126|ref|NC_015062.1|:149668-150210 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGCAAAAATAATTTCCTCACCTACAAGATGGCAGTATTTCAGCCTGTTTCTGCTCGCGGTTCTGCTTA
GCGGATGTGGCCTGACTCAGAAAGTGGTCGATGGCACCAAAGGCGTGACCAAAGCGATTTTCTATAAGCA
AATTAAAACACTGCATCTCGATTTTTCCCCGCGCACTTCTATGAACACAGATGAAGGCGATCAGTCATCA
CTTGCCACCATGGTGCGTGTTTATCAGCTTAAAGATCGCAAAGCCTTTGACGCTGCGGATTATGAAAAGC
TGCTGCTTCAGGCCGACAACCTGTTAAAAGCCGATGCCCTGGCCTCTAAGGAAGTGCTGGTGATGCCGGG
CGGTGATGTATCACTGGATATGCCCATGGAACCCGATGCTCAGTTTGTCGCCGTGGTGGCGTTGTTTCGC
AACCCGGACAGACAACATGATACCTGGCGGGTGGTCCTGAAACGGGAAGAGCTTGATCCCGACAAGCCCC
GCACGCTGGAACTCAGTAACGGGCAGCTTACGTTGTTACCACTCAAAGATTAA