SecReT6
Protein ID: 322835264
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4582
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]150223..152745 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDE8Y0Z7
KEGG IDrah:Rahaq_4582
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-56, Aligned region: 37..345
DUF2345 [PF10106], Evalue: 7.10E-34, Aligned region: 607..734
T6SS_Vgr [PF13296], Evalue: 2.20E-31, Aligned region: 477..580
T6SS_Vgr [PF13296], Evalue: 2.20E-31, Aligned region: 614..638
Phage_base_V [PF04717], Evalue: 8.30E-15, Aligned region: 391..472
Protein Sequence: 840 a.a.     [Download]
>gi|322835264|ref|YP_004215290.1| Rhs element Vgr protein [Rahnella sp. Y9602]
MVDILKNLLPDATGLSRYSLDIWNSPYSLDVLNFRGEEQLSETFSYTVDVTCPEPDIGAAQMLRQFASFT
MGTPFQPERAVYGVIRDFQRLSTSADETLYRLELVPRLRLLENSTNSFIFQNQSVPEVAEFILRKHGLEG
QDFEFRLSHTYPDRELITQWGETDLQFIKRILAEVGIWFRFEADTRLTCEKVLFGDGPEQYQFGVTLPYC
EPSGMRDGHAESVWGLKIHWNAVTGKIFKRDYNYREATTPLDVSAQVRSAAPVTGESYLYARPYREAGED
VDAAAETGAFYARIRHERKLNHQCRIFARTTGSGLAPGQVLEPQAYPFSDLPDGILITRIVAKGSRTEHF
RLNIWGMAYRETIGFRPEPPARPVLSGTIPARVESPTRGDTYAWLDNQGRYRVRIDGDRASADAGYAYLW
VRLAKPYGGDGYGWHMPLTDGTEVAIAFDGGDPDRPYIAAALHDSEHPDHVTERNHTRNVLRTPSNNKLR
MEDRRGEEHIKLATEYGKTQLNSGHIVDAQNAPRGEGFELRTDEHGVLRGGKGVFLSADAQPQGQVLDNS
AAMAEIEYLQGQVKALSLAAAEASALEADIAAQIAMFSERLKPINQVVLASAPQGIALTSGEHLQLAAAK
NMILNAGNNADIGVIKNLTVNTGEEMGIFALKGEMSLKAGEGRVDVQAQNNRLALAAGKKVSLTAVDGDI
LFSAKKRITLIGGGSYLILQDGKIEYGTAGEYFRKTPHTVLTVANPVRLKMPYLPGGGKFDLALDFRDED
SNAIANADYRIIFESGSVLAGKLDEQGYALHKNVPFESASVEYVLPEPLPDPDWERYTSLDAATDSLLTK
 
Nucleotide Sequence: 2523 bp     [Download]
>gi|322835126|ref|NC_015062.1|:150223-152745 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
GTGGTTGATATCCTGAAAAATCTTCTCCCTGATGCGACAGGTCTGTCCCGCTACTCACTTGATATCTGGA
ACAGCCCTTACAGTCTGGACGTGCTGAACTTTCGCGGCGAGGAACAGCTCAGCGAGACTTTTTCCTACAC
CGTTGACGTCACCTGCCCCGAACCGGATATCGGTGCCGCGCAGATGCTGCGCCAGTTCGCCAGCTTCACG
ATGGGCACGCCTTTCCAGCCTGAACGCGCCGTGTACGGCGTTATCCGTGACTTTCAGCGCCTGTCCACCT
CCGCCGACGAAACCCTGTACCGCCTTGAGCTGGTGCCGCGCCTGCGGCTGCTGGAAAACAGCACCAACAG
CTTTATTTTTCAGAACCAGTCGGTGCCCGAGGTGGCAGAGTTTATCCTGCGCAAACACGGGCTCGAGGGG
CAGGATTTTGAGTTTCGCCTCAGCCACACCTACCCCGACCGCGAACTCATCACCCAGTGGGGCGAGACCG
ACCTGCAGTTTATTAAACGCATTCTGGCCGAGGTCGGTATCTGGTTCCGCTTTGAGGCGGACACCCGCCT
GACGTGTGAAAAGGTGCTGTTCGGCGACGGGCCGGAGCAGTACCAGTTTGGCGTGACCCTGCCGTACTGC
GAGCCGTCGGGGATGCGCGACGGCCACGCCGAAAGCGTCTGGGGGCTGAAAATCCACTGGAACGCCGTCA
CCGGCAAAATCTTCAAACGCGATTACAACTACCGCGAGGCGACCACGCCGCTGGACGTCAGCGCGCAGGT
GCGCAGCGCCGCGCCGGTGACCGGCGAAAGCTACCTGTACGCTCGCCCTTACCGCGAGGCCGGTGAGGAC
GTGGACGCCGCCGCCGAAACCGGCGCGTTCTACGCCCGCATCCGCCATGAACGTAAACTCAATCATCAGT
GCCGGATATTCGCCCGCACCACCGGCAGCGGGCTGGCGCCGGGTCAGGTGCTGGAGCCGCAGGCCTATCC
GTTCAGCGACCTGCCGGACGGCATCCTCATTACCCGCATCGTCGCCAAAGGCTCACGCACCGAACATTTT
CGCCTCAATATCTGGGGGATGGCCTACCGCGAAACGATTGGCTTCCGCCCCGAACCACCGGCGCGGCCGG
TGCTCAGCGGCACGATACCGGCGCGGGTGGAAAGCCCGACCCGAGGCGACACCTACGCGTGGCTGGATAA
TCAGGGGCGCTACCGCGTGCGCATTGACGGCGACCGTGCGTCGGCGGATGCCGGTTACGCGTACCTGTGG
GTGCGCCTCGCCAAACCCTACGGCGGCGACGGCTACGGCTGGCATATGCCGCTGACCGACGGCACAGAAG
TGGCCATCGCCTTTGACGGCGGCGACCCCGACCGGCCGTATATCGCCGCCGCGCTGCACGACTCCGAACA
TCCCGACCATGTGACCGAACGGAACCACACCCGCAACGTTCTGCGCACCCCGTCAAATAACAAGCTGCGG
ATGGAGGACCGGCGCGGTGAGGAGCACATCAAACTCGCCACCGAATACGGCAAAACCCAGCTGAATAGCG
GGCATATCGTCGATGCGCAAAACGCACCGCGCGGCGAAGGTTTTGAGCTGCGCACCGATGAACACGGCGT
CCTGCGCGGCGGTAAGGGCGTCTTTCTCAGCGCGGACGCACAGCCGCAGGGTCAGGTGCTGGATAACAGC
GCGGCGATGGCTGAAATCGAATACCTGCAGGGTCAGGTGAAAGCCCTCAGCCTGGCCGCCGCCGAAGCCA
GCGCGCTGGAGGCCGATATCGCGGCGCAAATCGCCATGTTCAGCGAACGGCTGAAGCCGATAAATCAGGT
GGTGCTGGCCAGCGCGCCACAAGGGATTGCGCTGACCAGCGGCGAGCATCTGCAACTGGCCGCCGCCAAA
AACATGATACTGAACGCCGGTAACAATGCGGATATCGGGGTGATTAAGAACCTGACCGTCAACACTGGTG
AGGAAATGGGCATCTTTGCGCTGAAGGGCGAAATGAGCCTGAAGGCCGGCGAAGGCAGGGTCGACGTTCA
GGCGCAGAACAACCGGCTGGCGCTTGCGGCGGGCAAAAAAGTGAGCCTCACGGCGGTGGACGGCGACATC
CTGTTCAGCGCGAAAAAGCGCATCACGCTGATAGGCGGCGGCAGTTATCTCATCCTGCAGGACGGCAAAA
TTGAGTACGGCACGGCCGGTGAATATTTCAGGAAAACGCCGCATACGGTGCTGACGGTGGCGAACCCTGT
GCGACTGAAAATGCCCTATCTTCCGGGGGGCGGGAAGTTCGACCTGGCGCTGGATTTCAGGGATGAAGAC
TCAAATGCCATAGCCAACGCGGATTACCGCATCATATTCGAAAGCGGTTCGGTACTGGCTGGCAAGCTTG
ATGAACAGGGATATGCATTGCATAAAAATGTGCCGTTTGAATCAGCCAGTGTGGAATACGTTTTGCCCGA
ACCCTTACCGGATCCGGACTGGGAACGCTACACCTCACTTGATGCGGCAACGGACAGCCTTTTAACGAAA
TAA