SecReT6
Protein ID: 322835269
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4587
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]157534..159138 [+]
Producttype VI secretion-associated protein, VC_A0119 family
NoteTssA
UniProt IDE8Y102
KEGG IDrah:Rahaq_4587
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 67..127
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 158..183
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 242..261
Protein Sequence: 534 a.a.     [Download]
>gi|322835269|ref|YP_004215295.1| type VI secretion-associated protein, VC_A0119 family [Rahnella sp. Y9602]
MATLHTLLALCPQENPDILMQKAKVQTALWEKWLNPVSSDNATGEDPGYDDDFQRMREEVNKLSGADTEL
VCQLAEKLLTTVCKDVRVATYYLWARLHRDGESGLAEGLELLSGLVSRYGDQLLPSRKNSRRAAMEWLAG
SKVLDSLSLYPEVDKPKFERILAALTLFEYVITSWEDANRPQLGGLYDALESRLAQSGGFDAVVPQNSGG
QATSDSRSISPDMPTLKVIQSGRELLDQAKALAQYLRDQPQGWLSGHRLMTTIRWDTVDQLPPLDAKGCT
RLVPPRTDYRAQLKRLYLQQSWSELLENADRMFTEGVNHFWLDIQWYLHQALSKSGAPYDSWAEFIEQDL
RLLLLRLPGLETLAYSDGTPFADEVTAGWIARDIQDNDGRWQSEPNAVSASGDEDVLQLETEALAQADGE
GIEAALNWLQIRPGITTPRQRWLIRLLMARVAEQYGKNEMALHLLGELDSTGNSLTLKQWEPALLFEVKA
RRLKLLRMQFQRGDTDKAKLILEMDTLLAGLVSIDPARAAVLCA
 
Nucleotide Sequence: 1605 bp     [Download]
>gi|322835126|ref|NC_015062.1|:157534-159138 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGCCACATTACACACCCTGTTAGCGCTATGCCCACAGGAAAACCCAGATATATTGATGCAAAAGGCCA
AAGTGCAAACGGCGCTGTGGGAAAAATGGCTAAACCCGGTTAGCAGCGATAACGCAACTGGTGAAGATCC
CGGTTATGACGATGATTTTCAACGTATGCGTGAAGAAGTTAATAAGCTTTCAGGCGCGGATACTGAACTG
GTATGCCAGCTGGCGGAGAAATTACTGACCACTGTATGCAAAGACGTAAGGGTGGCCACTTATTACCTCT
GGGCACGATTGCATCGCGACGGCGAATCGGGTCTGGCCGAAGGGTTGGAGCTGTTGAGCGGACTGGTCTC
ACGCTATGGCGACCAGTTGTTGCCATCACGAAAAAATAGCAGGCGGGCTGCCATGGAGTGGCTGGCAGGA
AGTAAAGTCCTCGACAGCCTTTCGCTGTATCCCGAAGTCGATAAGCCAAAGTTTGAACGCATTTTGGCTG
CACTCACCCTGTTTGAATACGTTATTACATCATGGGAAGACGCAAACCGACCACAGTTGGGCGGTCTTTA
TGATGCCCTTGAATCCCGACTGGCTCAGTCTGGTGGCTTCGATGCCGTTGTTCCGCAAAATAGCGGCGGT
CAGGCAACGTCTGATTCGCGCTCCATCTCGCCGGACATGCCGACATTAAAGGTAATACAGTCTGGTCGTG
AGTTACTCGATCAGGCTAAGGCGTTAGCTCAGTACCTGCGAGACCAGCCACAAGGCTGGCTATCAGGACA
CCGCTTGATGACTACAATACGCTGGGACACCGTCGACCAACTACCTCCGCTGGACGCTAAAGGTTGTACT
CGCCTGGTACCACCCCGTACTGACTACCGTGCCCAACTCAAACGCCTGTATCTGCAACAAAGCTGGAGCG
AATTACTGGAAAATGCAGATAGGATGTTTACTGAAGGCGTGAACCATTTCTGGCTGGATATTCAATGGTA
CTTGCACCAGGCACTCAGCAAGTCGGGGGCGCCTTATGATAGTTGGGCAGAATTTATCGAACAGGATCTG
CGGTTATTGCTGCTTCGTTTACCGGGACTGGAAACGCTGGCCTACAGTGACGGTACCCCCTTTGCAGACG
AAGTGACCGCAGGCTGGATCGCTCGTGATATTCAGGACAATGACGGGCGATGGCAATCTGAACCCAATGC
AGTCTCTGCAAGTGGCGATGAAGATGTTCTTCAGCTTGAAACCGAAGCACTGGCGCAGGCAGACGGTGAA
GGTATTGAAGCTGCACTCAATTGGTTGCAGATTCGCCCGGGGATCACTACACCTCGCCAACGTTGGCTAA
TACGGCTGCTCATGGCTCGTGTTGCTGAACAATATGGAAAAAATGAAATGGCACTCCACTTACTTGGAGA
ACTGGACAGCACAGGAAATAGCCTCACGCTGAAGCAATGGGAGCCGGCCCTGCTGTTTGAAGTAAAAGCA
CGACGACTCAAACTGCTGAGAATGCAATTCCAGCGCGGCGATACTGATAAAGCAAAACTCATCCTCGAAA
TGGACACGCTACTCGCCGGATTGGTTTCAATTGATCCTGCGCGCGCGGCAGTGCTTTGTGCTTAA