SecReT6
Protein ID: 322835269
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4587
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]157534..159138 [+]
Producttype VI secretion-associated protein, VC_A0119 family
NoteTssA
UniProt IDE8Y102
KEGG IDrah:Rahaq_4587
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 67..127
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 158..183
ImpA-rel_N [PF06812], Evalue: 2.90E-21, Aligned region: 242..261
Protein Sequence: 534 a.a.     [Download]
>gi|322835269|ref|YP_004215295.1| type VI secretion-associated protein, VC_A0119 family [Rahnella sp. Y9602]
MATLHTLLALCPQENPDILMQKAKVQTALWEKWLNPVSSDNATGEDPGYDDDFQRMREEVNKLSGADTEL
VCQLAEKLLTTVCKDVRVATYYLWARLHRDGESGLAEGLELLSGLVSRYGDQLLPSRKNSRRAAMEWLAG
SKVLDSLSLYPEVDKPKFERILAALTLFEYVITSWEDANRPQLGGLYDALESRLAQSGGFDAVVPQNSGG
QATSDSRSISPDMPTLKVIQSGRELLDQAKALAQYLRDQPQGWLSGHRLMTTIRWDTVDQLPPLDAKGCT
RLVPPRTDYRAQLKRLYLQQSWSELLENADRMFTEGVNHFWLDIQWYLHQALSKSGAPYDSWAEFIEQDL
RLLLLRLPGLETLAYSDGTPFADEVTAGWIARDIQDNDGRWQSEPNAVSASGDEDVLQLETEALAQADGE
GIEAALNWLQIRPGITTPRQRWLIRLLMARVAEQYGKNEMALHLLGELDSTGNSLTLKQWEPALLFEVKA
RRLKLLRMQFQRGDTDKAKLILEMDTLLAGLVSIDPARAAVLCA
 
Nucleotide Sequence: 1605 bp     [Download]
>gi|322835126|ref|NC_015062.1|:157534-159138 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGCCACATTACACACCCTGTTAGCGCTATGCCCACAGGAAAACCCAGATATATTGATGCAAAAGGCCA
AAGTGCAAACGGCGCTGTGGGAAAAATGGCTAAACCCGGTTAGCAGCGATAACGCAACTGGTGAAGATCC
CGGTTATGACGATGATTTTCAACGTATGCGTGAAGAAGTTAATAAGCTTTCAGGCGCGGATACTGAACTG
GTATGCCAGCTGGCGGAGAAATTACTGACCACTGTATGCAAAGACGTAAGGGTGGCCACTTATTACCTCT
GGGCACGATTGCATCGCGACGGCGAATCGGGTCTGGCCGAAGGGTTGGAGCTGTTGAGCGGACTGGTCTC
ACGCTATGGCGACCAGTTGTTGCCATCACGAAAAAATAGCAGGCGGGCTGCCATGGAGTGGCTGGCAGGA
AGTAAAGTCCTCGACAGCCTTTCGCTGTATCCCGAAGTCGATAAGCCAAAGTTTGAACGCATTTTGGCTG
CACTCACCCTGTTTGAATACGTTATTACATCATGGGAAGACGCAAACCGACCACAGTTGGGCGGTCTTTA
TGATGCCCTTGAATCCCGACTGGCTCAGTCTGGTGGCTTCGATGCCGTTGTTCCGCAAAATAGCGGCGGT
CAGGCAACGTCTGATTCGCGCTCCATCTCGCCGGACATGCCGACATTAAAGGTAATACAGTCTGGTCGTG
AGTTACTCGATCAGGCTAAGGCGTTAGCTCAGTACCTGCGAGACCAGCCACAAGGCTGGCTATCAGGACA
CCGCTTGATGACTACAATACGCTGGGACACCGTCGACCAACTACCTCCGCTGGACGCTAAAGGTTGTACT
CGCCTGGTACCACCCCGTACTGACTACCGTGCCCAACTCAAACGCCTGTATCTGCAACAAAGCTGGAGCG
AATTACTGGAAAATGCAGATAGGATGTTTACTGAAGGCGTGAACCATTTCTGGCTGGATATTCAATGGTA
CTTGCACCAGGCACTCAGCAAGTCGGGGGCGCCTTATGATAGTTGGGCAGAATTTATCGAACAGGATCTG
CGGTTATTGCTGCTTCGTTTACCGGGACTGGAAACGCTGGCCTACAGTGACGGTACCCCCTTTGCAGACG
AAGTGACCGCAGGCTGGATCGCTCGTGATATTCAGGACAATGACGGGCGATGGCAATCTGAACCCAATGC
AGTCTCTGCAAGTGGCGATGAAGATGTTCTTCAGCTTGAAACCGAAGCACTGGCGCAGGCAGACGGTGAA
GGTATTGAAGCTGCACTCAATTGGTTGCAGATTCGCCCGGGGATCACTACACCTCGCCAACGTTGGCTAA
TACGGCTGCTCATGGCTCGTGTTGCTGAACAATATGGAAAAAATGAAATGGCACTCCACTTACTTGGAGA
ACTGGACAGCACAGGAAATAGCCTCACGCTGAAGCAATGGGAGCCGGCCCTGCTGTTTGAAGTAAAAGCA
CGACGACTCAAACTGCTGAGAATGCAATTCCAGCGCGGCGATACTGATAAAGCAAAACTCATCCTCGAAA
TGGACACGCTACTCGCCGGATTGGTTTCAATTGATCCTGCGCGCGCGGCAGTGCTTTGTGCTTAA

Protein ID: 322835273
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4591
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]160643..162037 [+]
ProductImpA domain protein
NoteTssA
UniProt IDE8Y106
KEGG IDrah:Rahaq_4591
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 9.80E-48, Aligned region: 113..147
DUF3702 [PF12486], Evalue: 9.80E-48, Aligned region: 302..449
ImpA-rel_N [PF06812], Evalue: 7.80E-21, Aligned region: 41..101
ImpA-rel_N [PF06812], Evalue: 7.80E-21, Aligned region: 356..373
Protein Sequence: 464 a.a.     [Download]
>gi|322835273|ref|YP_004215299.1| ImpA domain protein [Rahnella sp. Y9602]
MITQDKNRQLRTGDDPRALADYAVLREELSKLTHPARPDVDWKKVEHLCLNLFQQNGIELQTASWYTQAR
ARLAGMPGLNEGLAILEALISRQWPGLWPQPVHARMEILSGLSQRLQQILRGMSLEYHDLSQIYQAEKLI
ASLCNVLQRLELKHVSQLEALTSFMHGTAVRLENMHATSDAAIVLPAAAAEKAEKEWTAQPGEQWVYVAQ
SGPAEPQVIAPPSPVKRPVQWKGFIAGIVVTALAGTGFKAGMDAFYHPQTAEQLMATLPVLPKLLNAQTL
ETLKNQQAEMLHREAPAFLAATQQQTRQLAALPPRWAQDTGAQLVKQAQILWPDNPASQQLAKNWTQQLN
ASAIPLENLTGWQQANTQLQQLADKLNGLDEQRGKYMTVSQLKSSVFAIQQALNSSPPVEESLRKLAQDK
QQQKGISPQRIMQLDNQFTQLLNRYVLLLQNLPATTEKNGQADH
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|322835126|ref|NC_015062.1|:160643-162037 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGATAACCCAAGACAAAAACCGCCAGTTGCGCACCGGGGATGACCCGCGTGCGCTGGCTGATTACGCGG
TTTTACGCGAAGAACTGAGCAAATTAACCCATCCGGCGCGTCCCGATGTGGACTGGAAAAAGGTGGAACA
CCTGTGTCTGAACCTGTTCCAGCAAAACGGTATCGAGCTGCAAACGGCCTCCTGGTACACACAGGCCAGA
GCGCGGCTAGCGGGCATGCCGGGATTAAATGAAGGGCTGGCGATCCTCGAGGCATTAATTTCACGTCAGT
GGCCGGGACTGTGGCCGCAGCCGGTGCACGCGCGGATGGAAATTCTTTCGGGTCTGAGTCAGCGTCTTCA
GCAAATATTGCGCGGTATGTCACTGGAATATCATGATTTATCGCAGATTTATCAGGCAGAAAAACTGATC
GCTTCGCTTTGCAATGTGTTGCAACGCCTTGAACTGAAACACGTCAGCCAGCTGGAAGCACTGACTAGTT
TCATGCATGGTACTGCCGTCAGGCTGGAGAATATGCACGCGACCAGCGATGCAGCAATCGTTTTACCGGC
GGCAGCGGCAGAAAAAGCGGAAAAAGAGTGGACCGCGCAACCCGGTGAACAATGGGTGTATGTTGCGCAG
AGCGGACCTGCCGAACCGCAGGTGATTGCACCGCCTTCGCCAGTGAAACGTCCGGTGCAGTGGAAAGGGT
TTATCGCAGGTATCGTGGTGACGGCATTGGCCGGTACCGGTTTTAAAGCCGGGATGGATGCTTTTTATCA
TCCGCAAACGGCAGAGCAACTGATGGCGACGCTGCCGGTATTACCAAAATTGCTGAACGCACAGACGCTG
GAAACACTTAAGAACCAACAGGCTGAGATGCTCCACCGCGAGGCACCGGCATTTCTGGCCGCCACCCAAC
AGCAAACACGCCAGCTGGCAGCATTGCCGCCGCGCTGGGCACAGGACACCGGAGCACAACTGGTAAAACA
GGCGCAAATCCTCTGGCCGGATAACCCCGCATCTCAACAACTGGCAAAAAACTGGACACAACAGCTTAAC
GCCAGTGCGATACCGCTGGAAAACCTCACTGGCTGGCAACAGGCGAATACGCAGTTACAGCAACTGGCGG
ACAAACTCAACGGGCTGGATGAACAACGCGGTAAATACATGACCGTGTCGCAGCTAAAATCCTCGGTATT
CGCCATCCAGCAGGCGCTGAACAGTTCGCCGCCAGTCGAAGAATCGCTGCGCAAGCTGGCGCAGGATAAA
CAACAGCAAAAAGGCATATCCCCGCAACGGATTATGCAACTGGATAACCAGTTCACGCAGTTGCTGAACA
GGTATGTGTTGCTCCTCCAGAACTTACCGGCGACAACCGAAAAAAATGGTCAGGCAGATCACTAA