SecReT6
Protein ID: 322835270
SecReT6 ID422
T6SS typei2
Gene symbol-
Locus tagRahaq_4588
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]159158..159589 [+]
Producttype VI secretion system lysozyme-related protein
NoteTssE
UniProt IDE8Y103
KEGG IDrah:Rahaq_4588
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.80E-14, Aligned region: 29..115
Protein Sequence: 143 a.a.     [Download]
>gi|322835270|ref|YP_004215296.1| type VI secretion system lysozyme-related protein [Rahnella sp. Y9602]
MNSKSPSLYEILTGNFAGGLDLHNVSEENQVILSVLDNMQRILNCRAGTLTHLPDYGLPDMSKILQGMPG
TAHSLLTTLSGTLLKYEPRLRKINVILLPQSRPGHLEYALDAELKDLGLVRFGTEFMPEGRVLMRHMKQQ
NYV
 
Nucleotide Sequence: 432 bp     [Download]
>gi|322835126|ref|NC_015062.1|:159158-159589 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGAACTCAAAATCCCCCTCTCTTTATGAAATCCTCACTGGCAACTTTGCCGGCGGCCTCGACCTGCACA
ACGTCAGCGAAGAGAATCAGGTGATCCTCTCTGTGCTTGATAACATGCAGCGCATTCTTAACTGTCGCGC
GGGCACGCTTACGCACCTGCCCGATTATGGCTTGCCGGACATGAGCAAAATCCTGCAAGGGATGCCCGGC
ACGGCGCACTCGCTGCTGACCACGCTTTCCGGCACGTTACTCAAATACGAACCCCGCCTGAGAAAAATCA
ATGTGATATTGCTGCCGCAGTCCAGGCCGGGGCATCTTGAGTACGCCCTCGACGCCGAACTGAAAGACCT
CGGACTTGTGCGCTTCGGAACAGAGTTTATGCCGGAAGGCCGCGTGCTGATGCGTCATATGAAACAACAG
AATTACGTGTGA