SecReT6
Protein ID: 322835593
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4917
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]503886..504365 [+]
Producttype VI secretion protein, VC_A0107 family
NoteTssB
UniProt IDE8Y081
KEGG IDrah:Rahaq_4917
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-50, Aligned region: 8..147
Protein Sequence: 159 a.a.     [Download]
>gi|322835593|ref|YP_004215619.1| type VI secretion protein, VC_A0107 family [Rahnella sp. Y9602]
MSNTQYKLSKARPPRVQITYDVEVGGAESKKELPLVMGVIGNFAKDDLPLRDRRFTHIDKDNFNNVMEGM
KPAVDMLVESTLPEKEGQMAIALEFNSMDDFSPENVAMQVEPLRKLLELREQLSDLRNRTASNDRLKEQL
VELLEGMAKDAEPAKGEVE
 
Nucleotide Sequence: 480 bp     [Download]
>gi|322835126|ref|NC_015062.1|:503886-504365 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
GTGAGTAATACACAATATAAATTGAGCAAAGCGCGTCCCCCTCGCGTTCAAATTACGTACGACGTTGAAG
TTGGCGGTGCTGAATCCAAAAAAGAATTACCTCTGGTGATGGGGGTTATCGGGAATTTTGCTAAAGATGA
TTTGCCACTGCGCGACCGTCGTTTTACGCACATTGATAAAGACAACTTTAATAATGTCATGGAAGGAATG
AAGCCGGCTGTGGACATGCTGGTGGAAAGTACGTTGCCAGAAAAAGAAGGCCAGATGGCTATTGCACTGG
AATTCAACTCTATGGATGACTTCTCTCCTGAAAACGTGGCGATGCAGGTGGAACCGTTGCGCAAACTTCT
TGAATTACGCGAGCAACTGAGTGATTTGCGCAACAGAACTGCGAGCAATGACCGTCTGAAAGAGCAACTG
GTTGAATTATTAGAGGGTATGGCGAAAGACGCAGAACCTGCCAAAGGGGAAGTAGAATGA