SecReT6
Protein ID: 322835595
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4919
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]505873..506364 [+]
Producthypothetical protein
NoteTssD
UniProt IDE8Y083
KEGG IDrah:Rahaq_4919
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.60E-21, Aligned region: 7..137
Protein Sequence: 163 a.a.     [Download]
>gi|322835595|ref|YP_004215621.1| hypothetical protein Rahaq_4919 [Rahnella sp. Y9602]
MATESLFMQIDGIKGTVSNKGYEGWIAVENMNFGVYCSAKIDNASGQVNSDGVNFDAISFSKVMDTTSTQ
LSNMVAQGSNVKQIVIVKALFQGEKLVEALKLTYKNCVLNSYNFNAYSEGDVPSENLSFVFGQMTFETNM
VEPDGKTSKQGPVGWNLVENTKL
 
Nucleotide Sequence: 492 bp     [Download]
>gi|322835126|ref|NC_015062.1|:505873-506364 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGCTACTGAATCGCTTTTCATGCAAATTGATGGTATTAAAGGCACCGTAAGTAATAAAGGTTATGAAG
GTTGGATTGCCGTTGAGAATATGAATTTCGGTGTTTACTGCTCAGCTAAAATTGATAATGCCAGCGGTCA
GGTAAACAGCGATGGCGTCAACTTTGATGCAATTTCATTTTCAAAAGTAATGGATACTACCTCTACTCAG
TTATCCAATATGGTTGCGCAAGGCAGCAATGTTAAGCAAATTGTTATTGTTAAAGCATTGTTCCAGGGTG
AGAAACTGGTTGAAGCACTCAAGCTGACCTATAAAAACTGTGTACTGAACAGCTACAACTTCAACGCTTA
TTCAGAAGGGGATGTTCCGAGTGAAAATCTGAGCTTTGTATTTGGTCAGATGACATTCGAAACTAATATG
GTTGAGCCAGACGGTAAAACCAGCAAACAAGGTCCTGTGGGCTGGAATCTGGTTGAGAACACTAAGCTGT
AA