SecReT6
Protein ID: 322835596
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4920
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]506417..506833 [+]
ProductGPW/gp25 family protein
NoteTssE
UniProt IDE8Y084
KEGG IDrah:Rahaq_4920
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.80E-10, Aligned region: 25..114
Protein Sequence: 138 a.a.     [Download]
>gi|322835596|ref|YP_004215622.1| GPW/gp25 family protein [Rahnella sp. Y9602]
MKSLLQQLSDNNPKDQNDLIEEEDKSSTLIDEILLLLSSRPRSYRIDNIPLINESILNYGVSDVFSSDTP
RLERNAIMQSRIEMALQRFEPRLKNVCVTPGEELGSLCSFIINAETFNGEVRYRLMWDDVISQFSLRD
 
Nucleotide Sequence: 417 bp     [Download]
>gi|322835126|ref|NC_015062.1|:506417-506833 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGAAGAGCTTATTACAGCAATTATCTGACAATAACCCAAAAGATCAAAATGACCTTATTGAGGAAGAAG
ACAAAAGCAGCACACTCATTGACGAAATATTGCTGCTTTTGTCTTCACGCCCCCGAAGTTACCGCATTGA
TAATATTCCACTGATTAATGAGTCGATACTTAATTATGGAGTCAGTGACGTTTTTTCCAGTGATACGCCT
CGTCTTGAGCGCAATGCCATTATGCAATCACGTATTGAAATGGCATTACAACGCTTTGAACCAAGATTGA
AAAACGTCTGCGTGACCCCCGGTGAAGAACTGGGAAGTCTTTGTTCATTCATTATTAATGCTGAAACATT
CAATGGTGAAGTTCGCTACCGTCTAATGTGGGACGATGTCATCAGTCAATTTTCTCTGCGTGATTAA