SecReT6
Protein ID: 322835597
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4921
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]506846..508648 [+]
Producttype VI secretion protein, VC_A0110 family
NoteTssF
UniProt IDE8Y085
KEGG IDrah:Rahaq_4921
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-165, Aligned region: 7..596
Protein Sequence: 600 a.a.     [Download]
>gi|322835597|ref|YP_004215623.1| type VI secretion protein, VC_A0110 family [Rahnella sp. Y9602]
MLAKKLISYYQNELAYLKTQGKAFARHFPKVARRLGMSEGTSEDPHIERIIESFALVTAQIQQRLDEDMP
EVTDALLTVLAPQFLRPFPSVCVVQMQPDIKVSALTASNRIDAGTALFSRPVNGQVCRFRTTYPVTLQPV
SLHNVSLHLDADDMSWSLKIQLSVWPGATLAADSLRLHLSGASRIVNILYTLLCSEVESLTVFQQGQSHT
LSPQTIRAAGFGENEGLLAGDSRVSPTHSLLQDYFYFPQKFHFIDMPLPAGMVAGSQSELSLVVKFNRCM
IARQLEKIAGAVNENLFLLNCTPAVNLFAHRAEPISPDHETAEYPVIPDIRHQDAMEVWSVDGVSAMRKL
GNETQSRPVYPLFGLDHSASDGETGLFWQCMRRETMQNDGVATSLFIAFSDRGESPLAPGCDIVSMNLTC
TNREIPAAMRNGAPEGDFESELPIAGMKIIALTRPTLPVRPPAKQATRWRLISQLSLNHMLISGPEGARV
LRESLALYNFVDNPGITRLINLILHVESGPVVTRLAPLDPRSMARGMEIRITFASEAAEEVEYFLLCRFI
DCFLALYAPVNSFTRVITCIDSPGETPRTWPVRAGRLSWI
 
Nucleotide Sequence: 1803 bp     [Download]
>gi|322835126|ref|NC_015062.1|:506846-508648 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGTTGGCGAAAAAATTAATTTCTTATTATCAGAATGAACTCGCTTACCTCAAAACGCAGGGGAAGGCGT
TTGCCCGCCATTTCCCAAAAGTCGCCAGACGCTTAGGGATGTCAGAAGGTACGTCAGAAGATCCACATAT
TGAGCGAATTATTGAGTCCTTTGCGCTGGTCACGGCGCAGATTCAGCAACGTCTCGATGAGGATATGCCG
GAAGTGACTGATGCATTGCTGACGGTGTTGGCTCCGCAATTTTTGCGTCCTTTTCCTTCGGTTTGCGTCG
TACAAATGCAGCCAGATATCAAAGTCAGTGCGCTGACAGCCAGTAACCGCATTGACGCCGGAACAGCATT
ATTTTCCCGTCCGGTGAACGGACAGGTCTGCCGTTTTCGCACCACTTATCCGGTTACGCTTCAACCTGTC
AGTCTGCATAACGTCAGCCTGCATCTGGATGCCGATGACATGAGCTGGAGTCTGAAAATACAATTATCGG
TCTGGCCCGGTGCCACACTGGCGGCGGATTCCCTGAGGTTGCATCTCAGCGGCGCCAGTCGCATCGTCAA
CATCCTTTATACCTTGCTGTGCAGCGAAGTTGAGTCACTGACAGTTTTCCAGCAAGGGCAGAGTCATACG
CTGTCGCCGCAAACTATACGTGCCGCAGGCTTCGGTGAAAATGAAGGCTTGCTTGCGGGTGATTCACGGG
TTTCGCCCACTCACAGCCTGTTGCAGGACTATTTTTACTTCCCGCAAAAGTTTCATTTTATTGATATGCC
GTTGCCTGCTGGCATGGTGGCGGGCAGTCAAAGCGAGCTTTCACTGGTGGTGAAATTCAACCGCTGCATG
ATAGCGCGTCAGTTGGAGAAAATAGCTGGTGCGGTGAACGAAAACCTGTTTCTGCTCAACTGCACGCCTG
CTGTTAATCTTTTCGCCCATCGGGCCGAACCGATTTCACCTGATCACGAAACGGCGGAATATCCGGTTAT
CCCTGACATTCGTCACCAGGATGCGATGGAAGTCTGGTCTGTAGACGGCGTTTCGGCGATGCGCAAACTG
GGCAATGAAACACAGTCCCGGCCTGTTTATCCATTGTTTGGTTTGGACCATTCCGCCAGTGACGGTGAAA
CCGGTTTGTTCTGGCAATGTATGCGCCGAGAAACCATGCAAAATGACGGTGTCGCCACATCGTTATTTAT
CGCTTTTTCTGACCGGGGAGAAAGCCCGTTAGCGCCCGGTTGCGACATTGTCAGCATGAACCTGACCTGC
ACCAATCGTGAGATTCCCGCAGCCATGCGCAACGGCGCTCCTGAAGGCGATTTCGAATCAGAGCTGCCGA
TTGCGGGCATGAAAATTATTGCGCTGACACGCCCGACGCTGCCGGTCAGGCCACCGGCTAAGCAGGCTAC
GCGCTGGCGTTTGATTTCTCAGCTTTCGCTCAACCATATGTTGATCAGTGGGCCGGAAGGCGCCCGTGTA
CTCAGGGAATCACTGGCGCTTTACAACTTTGTCGATAATCCGGGCATTACCCGCTTGATCAACCTGATCC
TGCATGTCGAGTCTGGCCCGGTCGTTACCCGGCTGGCGCCTTTGGATCCCCGTTCCATGGCGCGGGGGAT
GGAGATCCGCATAACCTTTGCCAGCGAAGCGGCCGAAGAAGTTGAGTACTTCCTGCTGTGTCGCTTTATT
GATTGTTTCCTGGCGTTGTACGCACCGGTCAACAGTTTCACCCGTGTAATCACCTGCATTGACTCACCGG
GTGAAACTCCACGGACGTGGCCTGTGCGGGCAGGAAGGCTGTCATGGATCTAA