SecReT6
Protein ID: 322835598
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4922
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]508639..509586 [+]
Producttype VI secretion protein, VC_A0111 family
NoteTssG
UniProt IDE8Y086
KEGG IDrah:Rahaq_4922
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-67, Aligned region: 10..296
Protein Sequence: 315 a.a.     [Download]
>gi|322835598|ref|YP_004215624.1| type VI secretion protein, VC_A0111 family [Rahnella sp. Y9602]
MDLSKILSPHNFFQQVRLMLRSLTRAQGKDSKQVLEAQLDFISPLSLDAPKGDITSVTPLDQQRWQVEVA
AQGLTGALGALPTVYTEWMIDRYYRHGDKTAKAFLDIFNHRLHSLRYLAWQKYHYYAMAEFSATRPLSQA
IRALSGVANSAPSLQQEQFADLFAHSVRSMLNVETWLKHRFSVAAKVTPFTGGWQVMDPAQCCRLGEPSH
TLAAAPMLGSVYWDRQSHFTVTLGPVPMKNAGLFLPKGKHYQNLWSHLREYVGPGLDFDIDLLIENTTNV
VTSLGCGQLGLDICLGASEGAGQHKIRLPVCREGK
 
Nucleotide Sequence: 948 bp     [Download]
>gi|322835126|ref|NC_015062.1|:508639-509586 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGATCTAAGCAAAATCCTCAGTCCGCATAACTTTTTCCAACAGGTGCGGCTGATGTTACGCAGTCTGA
CCAGAGCACAGGGAAAAGACAGCAAACAGGTGCTCGAAGCGCAACTTGATTTCATTTCACCGCTCTCGCT
GGATGCGCCGAAAGGTGACATTACGTCGGTAACTCCGCTGGATCAGCAGCGCTGGCAAGTTGAAGTGGCC
GCCCAGGGACTGACGGGGGCACTGGGCGCGTTACCCACGGTATACACCGAGTGGATGATCGACCGCTATT
ACCGCCATGGGGACAAAACTGCCAAAGCTTTTCTGGACATTTTTAACCACCGGCTACATAGCCTGCGCTA
TCTCGCCTGGCAGAAATATCACTATTACGCCATGGCAGAATTCAGTGCAACACGGCCGCTGAGTCAGGCC
ATCCGTGCGTTATCCGGCGTGGCAAACAGTGCGCCATCTCTGCAGCAGGAGCAGTTTGCTGATTTATTTG
CGCATTCAGTGCGCTCAATGCTCAACGTTGAAACCTGGTTAAAACACCGCTTTTCCGTGGCGGCGAAAGT
CACGCCTTTTACCGGCGGATGGCAGGTCATGGACCCGGCCCAGTGTTGCCGGCTGGGAGAACCGTCACAT
ACGCTGGCCGCTGCTCCCATGCTGGGCAGCGTGTACTGGGATCGGCAATCACATTTTACGGTGACACTGG
GACCGGTGCCGATGAAAAACGCCGGTCTTTTTTTGCCAAAGGGCAAGCACTACCAAAATCTGTGGTCGCA
TCTGCGTGAATACGTTGGTCCGGGTCTGGATTTTGATATTGATCTGCTGATCGAAAATACCACGAACGTC
GTTACCTCGTTGGGGTGCGGGCAACTCGGGCTGGATATTTGTCTCGGGGCCTCCGAGGGAGCAGGCCAGC
ATAAAATTCGTTTACCCGTCTGCCGGGAAGGAAAATAA