SecReT6
Protein ID: 322835599
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4923
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]509590..511503 [+]
Producttype VI secretion system Vgr family protein
NoteTssI
UniProt IDE8Y087
KEGG IDrah:Rahaq_4923
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-57, Aligned region: 31..325
Phage_base_V [PF04717], Evalue: 4.00E-23, Aligned region: 359..451
DUF2345 [PF10106], Evalue: 0.0017, Aligned region: 533..624
Gp5_C [PF06715], Evalue: 0.0046, Aligned region: 499..518
Gp5_C [PF06715], Evalue: 0.0046, Aligned region: 528..550
Gp5_C [PF06715], Evalue: 0.0046, Aligned region: 620..634
Protein Sequence: 637 a.a.     [Download]
>gi|322835599|ref|YP_004215625.1| type VI secretion system Vgr family protein [Rahnella sp. Y9602]
MSKVVGQDNRFIRFVGDAADSLTLMYIEGDEQFSDTFSYQVQFRTSLITPQMGRFLGHEMACEIGRGNQK
RYVHGVLTQIKEDNNVDGISTFTGTLEPRMALLRLGRNLAVFQNITVPDLVCKLLRQQNISHIDLRLRAT
YQPREYCIQYRESDFDFISRLLEQEGIYYFFQHDAGQHTLVLADHPSSHQSGKTAELPFMPLQGRGDGVG
ILNWVASSSLAASSVMLKGFNIVQAASVEGESKAVEAEYSVPGVSYVDAHGHEKRELLQSEARLKMEQLE
ADNQQFYAEASVWWLGCGDKFLLSGHPSCRGNYRIKSVHMHASSNIDDGQPDFGYALTVLKDSLSWRPPC
LTRQPEIAGILTAIVVGPKSEEVHTDEYGRIKIQFPWDRENKHDDGSSCWVRVSQPWAGGRFGAMFLPRV
NSEVTVSFVHGNPDYPLVTGSVYNGQNKPPLSLPEEKNHAGFVSRSSLNGNVEEGHELRFDDKKGEERLV
ITSQKDLLLTVKNDVTTRITKNVTETIGENRTTELTKGNESLTLKQGDYALDIKGNLQESLTSGNHQLNI
SGGGSTVKADKACVIESTQSIELKVGSSKITLSPSGITLSGTTIKIEGKGTAELKGAMVTVQGSGMTQIK
GGVTMIG
 
Nucleotide Sequence: 1914 bp     [Download]
>gi|322835126|ref|NC_015062.1|:509590-511503 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGTCGAAAGTAGTAGGACAAGACAACCGGTTTATCCGTTTCGTTGGCGATGCCGCTGATTCACTGACGC
TGATGTATATCGAGGGCGATGAACAATTCTCTGACACCTTCAGCTATCAGGTCCAGTTTCGCACGTCGTT
AATAACTCCGCAGATGGGGCGTTTTCTGGGGCATGAAATGGCCTGTGAGATTGGCCGTGGCAACCAAAAG
CGCTACGTGCATGGTGTGCTGACACAGATTAAAGAAGACAATAATGTCGATGGCATCAGTACCTTCACCG
GTACGCTGGAACCGCGCATGGCATTGTTGCGTCTCGGGCGTAACCTGGCGGTTTTCCAGAATATTACCGT
ACCGGATTTAGTGTGCAAGCTGCTGCGCCAGCAGAACATCAGCCACATTGATTTGCGTCTGCGTGCGACT
TATCAGCCGCGTGAATACTGCATTCAGTATCGCGAATCCGATTTTGACTTCATTAGCCGCCTTCTTGAGC
AGGAAGGGATCTATTACTTCTTCCAGCATGATGCCGGGCAACACACGCTGGTACTGGCCGATCATCCGTC
CAGCCATCAGTCTGGCAAAACGGCGGAGTTACCCTTTATGCCACTGCAGGGGCGAGGCGATGGCGTCGGT
ATCCTGAACTGGGTGGCCAGTTCTTCACTGGCGGCCTCTTCCGTGATGCTCAAAGGTTTTAACATTGTGC
AGGCAGCCAGTGTGGAGGGCGAATCGAAAGCCGTGGAAGCGGAATATTCCGTGCCGGGTGTCAGCTACGT
GGACGCGCACGGCCATGAAAAACGCGAATTACTGCAATCAGAAGCCCGGCTGAAGATGGAACAGCTTGAG
GCCGATAACCAGCAGTTTTACGCCGAAGCCAGCGTGTGGTGGCTAGGCTGTGGCGATAAATTCCTTCTGA
GCGGGCATCCTTCCTGTCGGGGAAACTACCGAATCAAGTCGGTTCATATGCATGCATCAAGCAACATTGA
TGACGGGCAGCCTGATTTTGGCTACGCGCTCACTGTGTTGAAAGACAGCCTTTCCTGGCGTCCGCCGTGC
CTCACCAGACAACCTGAAATCGCCGGTATTCTGACCGCCATCGTTGTCGGGCCAAAATCAGAAGAAGTCC
ACACGGACGAATATGGCCGCATCAAAATTCAGTTCCCGTGGGATCGCGAAAACAAACATGACGATGGCAG
TTCCTGCTGGGTGCGGGTTTCGCAGCCGTGGGCGGGTGGCCGTTTCGGCGCCATGTTCCTGCCTCGCGTC
AACAGCGAAGTTACGGTCAGCTTTGTGCATGGCAACCCTGATTATCCTCTGGTGACCGGCTCGGTATACA
ACGGGCAAAACAAACCGCCGCTGAGCCTGCCTGAGGAGAAAAATCACGCCGGATTCGTTTCACGCAGCTC
CCTCAACGGCAATGTTGAAGAAGGCCATGAGTTGCGCTTCGACGATAAAAAAGGCGAAGAGCGTCTGGTC
ATCACCTCGCAAAAAGATCTGCTGCTGACAGTGAAAAACGACGTCACCACCCGTATTACCAAAAACGTCA
CTGAAACCATTGGTGAGAACCGCACGACCGAGTTAACCAAAGGTAATGAAAGCCTGACGCTTAAACAGGG
CGATTATGCCCTGGATATTAAAGGCAATTTGCAGGAAAGCCTGACCAGCGGTAACCATCAGCTAAACATC
AGTGGTGGCGGTAGCACGGTCAAAGCGGACAAAGCCTGCGTTATTGAATCGACCCAGTCTATCGAATTAA
AAGTCGGTAGCAGCAAAATTACTCTTTCTCCTTCCGGCATTACGCTGAGCGGCACCACGATCAAAATTGA
AGGGAAGGGCACGGCAGAACTTAAAGGTGCGATGGTCACTGTTCAGGGTAGCGGTATGACCCAGATCAAG
GGCGGCGTGACGATGATTGGCTGA