SecReT6
Protein ID: 322835602
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4926
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]512343..513407 [+]
Producttype VI secretion-associated protein, ImpA family
NoteTssA
UniProt IDE8Y090
KEGG IDrah:Rahaq_4926
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.80E-19, Aligned region: 55..116
Protein Sequence: 354 a.a.     [Download]
>gi|322835602|ref|YP_004215628.1| type VI secretion-associated protein, ImpA family [Rahnella sp. Y9602]
MIMNFEPLLAPFSGDHPVGRNMEYEPVYNEIREARESDPDYLPQGEWATELRKADWSKVVRLSAKVLQAE
SKDLQVACWLIEGLSQQHGIRGLLDGTGFLIPFIQTYWQTGWPELDEDGVIIRHGMINRLDRQLAQMLHC
HPLFGQPESTLDHWRKVLAYEHRVTMKPDSAAERGSDDDFSMDTFNRWAATLDPQKVAAQNEALTQLMTM
LDTLETLYGQLNPQADSLAMGQMRSAVAEMQEFVKRLFDRAAPAYDDVMTLNVLMPDEDEQANDVSSLMN
NTKKQTMSRDLAISQMLTIAHFFRQTEPSSPVPFLMERAARWAAMTLTEWLEEMLQDDSSMRDINKVLKG
HGRE
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|322835126|ref|NC_015062.1|:512343-513407 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGATAATGAATTTTGAGCCCTTGCTTGCCCCGTTCAGTGGCGATCATCCTGTCGGGCGCAACATGGAAT
ATGAGCCGGTCTATAACGAAATCCGTGAGGCGCGGGAAAGCGATCCTGACTATTTGCCGCAGGGCGAATG
GGCCACTGAATTGCGTAAAGCCGACTGGAGCAAAGTCGTTCGCTTAAGCGCGAAGGTTTTGCAGGCAGAA
AGCAAAGATTTGCAGGTGGCTTGCTGGCTGATCGAAGGGTTGAGCCAGCAGCACGGGATCCGCGGCCTGC
TGGACGGTACCGGTTTTCTGATACCGTTTATACAAACTTACTGGCAAACCGGCTGGCCGGAGCTGGATGA
GGACGGCGTCATAATCCGCCATGGCATGATTAATCGTCTGGACCGCCAGTTGGCGCAAATGCTGCATTGT
CATCCTCTGTTTGGACAGCCGGAAAGCACGCTGGATCACTGGCGCAAGGTGCTCGCTTATGAGCACCGGG
TGACGATGAAACCTGACAGCGCTGCGGAACGGGGCAGTGACGATGATTTCTCGATGGATACCTTCAACCG
TTGGGCTGCCACACTGGATCCGCAGAAAGTTGCCGCACAGAACGAGGCGTTAACTCAACTGATGACTATG
CTGGATACGCTTGAAACCCTCTATGGTCAGCTGAATCCGCAGGCTGATTCTCTGGCAATGGGGCAGATGC
GTAGTGCCGTCGCCGAAATGCAGGAATTTGTGAAACGCCTGTTTGACCGTGCGGCACCGGCATATGACGA
CGTGATGACCCTTAACGTATTAATGCCTGACGAAGATGAGCAAGCCAATGACGTCAGTTCACTGATGAAT
AACACCAAAAAACAAACGATGTCACGGGATCTGGCCATCAGCCAGATGCTGACCATTGCCCATTTTTTCC
GTCAGACCGAACCGTCAAGCCCCGTCCCTTTTCTGATGGAGCGTGCGGCGCGCTGGGCGGCTATGACGTT
GACCGAATGGCTGGAAGAGATGTTGCAGGATGACAGCAGTATGCGCGATATCAACAAAGTATTGAAAGGA
CACGGCAGAGAATGA