SecReT6
Protein ID: 322835603
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4927
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]513404..513979 [+]
Producttype VI secretion lipoprotein, VC_A0113 family
NoteTssJ
UniProt IDE8Y091
KEGG IDrah:Rahaq_4927
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.50E-20, Aligned region: 15..176
Protein Sequence: 191 a.a.     [Download]
>gi|322835603|ref|YP_004215629.1| type VI secretion lipoprotein, VC_A0113 family [Rahnella sp. Y9602]
MRGKRGLTGLILSVMLLAGCASDDGQSRQKAISEVAAPFANGAITLQLRAEPGLNSLNDMPNSCTVLLLQ
AKDKPTLDKILGNPATLKSLFAGAGSEGDVLQVDRYVMMPGQTNTVHIDRARDTRNVALVAGYYPFPVKK
HMVSALVPVESESTGWWEPVWQAHLAPVTLSVTLGSESIVSADVPVAGEKK
 
Nucleotide Sequence: 576 bp     [Download]
>gi|322835126|ref|NC_015062.1|:513404-513979 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGAGGGGGAAAAGGGGACTGACCGGGCTGATACTGAGTGTCATGCTGCTGGCAGGTTGCGCGTCAGATG
ATGGGCAAAGCCGTCAGAAGGCGATCAGTGAAGTGGCTGCGCCTTTCGCGAATGGGGCTATCACTCTGCA
ACTGCGGGCTGAGCCGGGGCTGAACAGCCTGAACGACATGCCCAACAGCTGTACAGTATTACTGCTACAA
GCCAAGGATAAACCGACGCTGGATAAAATACTGGGTAATCCCGCGACGCTGAAAAGCTTGTTTGCCGGTG
CCGGCAGCGAAGGAGACGTTTTGCAGGTGGATCGTTACGTCATGATGCCGGGACAAACCAACACGGTGCA
TATTGATCGCGCCCGAGATACCCGCAATGTGGCGCTGGTCGCAGGCTACTATCCGTTCCCGGTAAAGAAA
CACATGGTCAGCGCACTGGTGCCGGTAGAGTCTGAGAGCACTGGCTGGTGGGAGCCTGTCTGGCAGGCGC
ATTTAGCGCCGGTCACTCTTTCTGTCACCTTAGGCAGTGAAAGTATTGTCAGTGCAGATGTCCCTGTTGC
CGGAGAGAAAAAATAA