SecReT6
Protein ID: 322835604
SecReT6 ID424
T6SS typei4b
Gene symbol-
Locus tagRahaq_4928
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]513979..515373 [+]
Producttype VI secretion protein, VC_A0114 family
NoteTssK
UniProt IDE8Y092
KEGG IDrah:Rahaq_4928
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.00E-88, Aligned region: 20..461
Protein Sequence: 464 a.a.     [Download]
>gi|322835604|ref|YP_004215630.1| type VI secretion protein, VC_A0114 family [Rahnella sp. Y9602]
MYPEQQQIYWHSGLYLQPQHFQSLDLHYEWNLAQHLRLAQPYNHGLIEVSINEAALSDYVISVEQIRCIL
PGGTLLSLPGNSRVEQRNFRDLWKQRDQPLTIWLALRRFDPLHSNVTTLEKEHDRAVTRWINTSEERVMK
DVYDHAPDAAVARLCYNVRLLTDVEKDDAVDCECIPLTRLRYENERVILDPTFSPPSVTLFGSFSLGKLI
DTIYFELSARARKLEEYKRSERLVSDADRGDQVTQLLAMRSLNRVLPQLKNFCQARQVHPWQVYNVLCQL
VGDLSSFNDSCTFLGEWHDGENSLQTYNHNELLSCFESARKTLITLLNSLVLEDNTYITLENDLQGVFTG
SFDSAQSKNPETVLLLLRSASMPMENRQIKNPGGIKLASPRMIEPLIQHALPGIPVVRCPQPPRGVPNRR
DSHYFLVEQDSELWNKARQHSSISFYWPDMPEDLQVQIIFVVPS
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|322835126|ref|NC_015062.1|:513979-515373 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGTATCCAGAACAACAGCAAATTTACTGGCATTCCGGGCTTTATCTGCAGCCGCAGCACTTTCAGTCAC
TTGACCTGCATTATGAATGGAACCTCGCGCAGCATTTGCGGCTGGCGCAGCCCTATAATCACGGGCTGAT
TGAGGTGAGTATTAATGAAGCAGCACTGAGCGACTACGTGATCAGCGTTGAGCAGATCCGTTGTATTTTG
CCCGGCGGTACCTTGCTCTCACTGCCCGGCAACAGCCGTGTTGAACAACGCAACTTCCGTGACCTCTGGA
AACAGCGCGATCAGCCGCTGACCATCTGGCTGGCTTTACGTCGCTTTGATCCGCTGCACAGTAATGTCAC
CACGCTGGAAAAAGAGCATGATCGCGCCGTCACGCGCTGGATCAACACCAGCGAAGAGCGGGTGATGAAA
GATGTCTATGATCATGCGCCGGATGCTGCAGTGGCACGCCTGTGCTACAACGTCAGGTTGCTGACGGACG
TTGAAAAAGACGATGCGGTTGACTGCGAATGCATTCCACTCACCCGACTGCGTTATGAAAACGAACGGGT
GATCCTCGATCCGACATTCTCGCCACCTTCCGTGACACTTTTTGGATCATTCAGCCTCGGCAAGCTGATT
GACACTATTTATTTTGAACTGAGTGCGCGGGCCAGGAAGCTTGAAGAATACAAACGCTCAGAGCGACTGG
TCAGCGATGCCGACCGTGGCGACCAGGTGACACAGTTGTTAGCGATGCGTTCTCTCAACCGGGTGTTGCC
ACAACTGAAAAATTTCTGTCAGGCGCGCCAGGTTCATCCATGGCAAGTCTACAACGTGTTGTGCCAGCTG
GTGGGCGATCTTTCCTCATTCAATGACAGCTGCACCTTCCTTGGTGAGTGGCACGACGGTGAAAATTCAC
TGCAAACCTACAACCACAATGAATTGCTGAGTTGTTTCGAAAGCGCCCGTAAGACGCTGATTACCTTGTT
GAACAGTCTGGTGCTTGAGGACAATACGTATATCACGCTGGAAAACGATCTTCAGGGCGTGTTCACCGGA
AGCTTTGACAGCGCGCAGAGCAAAAATCCCGAAACGGTACTGCTGCTGTTACGTTCCGCCAGCATGCCGA
TGGAAAATCGTCAGATAAAAAATCCGGGTGGCATCAAACTGGCTTCACCAAGAATGATCGAACCACTGAT
CCAGCATGCTCTGCCGGGCATTCCGGTAGTTCGTTGTCCACAGCCACCGCGGGGTGTACCAAACCGCAGA
GATTCGCATTATTTCCTTGTCGAGCAGGATAGCGAATTGTGGAACAAAGCCCGGCAGCACAGCAGCATTT
CCTTCTACTGGCCAGACATGCCGGAAGATCTTCAGGTGCAAATTATATTTGTGGTGCCTTCATGA